KEGG   Mus musculus (mouse): 70257
Entry
70257             CDS       T01002                                 

Gene name
Atp5mpl, 2010107E04Rik, 9430003J03Rik, AU043134, AV124504, Atp5mj, MLQ, Mp68
Definition
(RefSeq) ATP synthase membrane subunit 6.8PL
  KO
K18193  6.8 kDa mitochondrial proteolipid
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    70257 (Atp5mpl)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-V assembly factors
    70257 (Atp5mpl)
Motif
Pfam: Mit_proteolip
Other DBs
NCBI-GeneID: 70257
NCBI-ProteinID: NP_081636
MGI: 1917507
Ensembl: ENSMUSG00000021290
UniProt: P56379
Position
12; 12 F1
AA seq 58 aa
MFQTLIQKVWVPMKPYYTQVYQEIWVGVGLMSLIVYKIRSADKRSKALKGPAPAHGHH
NT seq 177 nt   +upstreamnt  +downstreamnt
atgtttcaaaccttgattcaaaaagtctgggtccccatgaaaccctactatacccaggtt
taccaggaaatttgggtaggagtggggttaatgagcctcatcgtatataaaatcaggagt
gctgataaaagaagtaaagctttgaaaggtcctgcacctgcccatggccatcactaa

DBGET integrated database retrieval system