KEGG   Mus musculus (house mouse): 70285
Entry
70285             CDS       T01002                                 
Symbol
Rpf1, 2210420E24Rik, 2310066N05Rik, Bxdc5
Name
(RefSeq) ribosome production factor 1 homolog
  KO
K14846  ribosome production factor 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    70285 (Rpf1)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    70285 (Rpf1)
SSDB
Motif
Pfam: Brix Peptidase_S30
Other DBs
NCBI-GeneID: 70285
NCBI-ProteinID: NP_081647
MGI: 1917535
Ensembl: ENSMUSG00000028187
Position
3:complement(146212099..146227184)
AA seq 349 aa
MAKAGEKSVGGGKRGLKRKAAAEEPQEAAAASDGTAESGVQPAKAAAFPPGFSISEIKNK
QRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGDKAPPKPVPKTIDNQRVYDETTVDPND
EEVAYDEATDEFASYFNRQTSPKILITTSDRPHGRTVRLCEQLSTVIPDSHVYYRRGLAL
KKIIPQCIARDFTDLIVINEDRKTPNGLILSHLPNGPTAHFKMSSVRLRKEIKRRGKDPT
EHVPEIILNNFTTRLGHSIGRMFASLFPHNPQFIGRQVATFHNQRDYIFFRFHRYIFKSE
KKVGIQELGPRFTLKLRSLQKGTFDSKYGEYEWVHKPREMDTSRRKFHL
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggcgaaggccggcgagaaaagtgttggtggcggcaagcgaggcttgaagaggaaagct
gccgctgaagagcctcaagaggctgcggccgcgagcgatgggacggcggagagcggggtg
cagcccgcgaaagcggccgccttccccccgggcttcagtatctcggagattaagaacaag
cagcggcgacacttgatgttcacgcggtggaaacagcagcagcggaaggaaaagttggca
gctaagaaaaaacttaaaaaggagagagaggctcttggcgataaggctccaccaaagcct
gttcccaagaccattgacaaccagcgcgtttacgacgagaccacagtagaccccaatgat
gaagaggtggcttacgatgaagcgacggatgaatttgcttcttacttcaacagacagacg
tctcctaagattcttatcacaacgtcagatagacctcatgggagaacagttcgactctgt
gagcagctctcaacagttataccagattcacatgtttattacagacgaggactggctctg
aaaaaaattatcccacagtgcattgcaagagatttcacagacctgatcgttattaatgaa
gatcgtaaaacaccgaatggacttattttgagtcatttgccaaacggtccaaccgctcat
tttaaaatgagcagtgttcgtcttcgtaaagaaattaagcgaagaggcaaagaccccaca
gaacatgtacctgagataattctgaataattttaccacacggctaggccattctattgga
cgcatgtttgcttctctctttcctcataatcctcaatttattggaagacaagttgccacg
ttccacaatcagcgagattacatcttcttcaggtttcacagatacatattcaagagtgag
aagaaagtgggaattcaggaactcggaccacgttttaccttaaaattacgatctcttcag
aagggcacttttgattctaaatatggagagtacgaatgggtccacaagccacgggaaatg
gatacaagtcgaaggaaattccacttataa

DBGET integrated database retrieval system