KEGG   Mus musculus (mouse): 70296
Entry
70296             CDS       T01002                                 

Gene name
Tbc1d13, 2600014A06Rik, BC025586
Definition
(RefSeq) TBC1 domain family, member 13
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: RabGAP-TBC TFIID_20kDa
Other DBs
NCBI-GeneID: 70296
NCBI-ProteinID: NP_666364
MGI: 2385326
Ensembl: ENSMUSG00000039678
Vega: OTTMUSG00000016741
UniProt: Q8R3D1 Q3TZ63
Position
2; 2 B
AA seq 400 aa
MSSLHKSRIADFQDVLKEPSIVLEKLRELSFSGIPCEGGLRCLCWKILLNYLPLERASWT
SILAKQRGLYSQFLREMIIQPGIAKANMGVFREDVTFEDHPLNPNPDSRWNTYFKDNEVL
LQIDKDVRRLCPDISFFQRATEYPCLLILDPQNEFETLRKRVEQTTLKSQTVARNRSGVT
NMSSPHKNSAPSALNEYEVLPNGCEAHWEVVERILFIYAKLNPGIAYVQGMNEIVGPLYY
TFATDPNSEWKEHAEADTFFCFTNLMAEIRDNFIKSLDDSQCGITYKMEKVYSTLKDKDV
ELYLKLQEQSIKPQFFAFRWLTLLLSQEFLLPDVIRIWDSLFADGNRFDFLLLVCCAMLI
LIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDSK
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgtcgagtctgcacaagagccggattgcagatttccaggatgtcctgaaggagccctcc
attgtgttggaaaagcttcgagaactcagttttagtggcatcccctgtgagggcggactg
cggtgcctctgctggaagatcctcctgaactacctccctctggagagagcctcgtggact
tccatcctggccaagcagagggggctctattcgcagttcctgagagagatgattatccag
cctggcattgccaaggccaacatgggtgtattcagggaggatgtgacctttgaggaccat
cctctgaacccaaaccctgacagcaggtggaacacatattttaaggacaacgaggtgcta
ctccagattgacaaagatgtcaggaggttgtgcccagatatatctttcttccaaagagcc
actgagtacccctgcctgctcatcctggacccgcaaaatgagtttgagacccttcgtaag
cgggtggagcagacgacactgaagtctcagacggtggccaggaatcgaagcggggttaca
aatatgagctccccgcacaagaacagtgcgccatcagccctgaacgagtatgaggtgcta
cccaatggctgcgaagcccactgggaggtggtggagcgcatcctgttcatctatgccaag
ctcaaccctggcatcgcttacgtgcagggcatgaatgagatcgtgggccccctctactac
acttttgccactgaccctaacagcgagtggaaagagcacgctgaagcagatacctttttc
tgcttcaccaacctcatggctgagatccgggacaacttcatcaagagcctggatgactcc
cagtgcggtatcacctacaagatggaaaaggtgtactccaccttgaaggataaggatgta
gagctctacctgaagctgcaagagcagagtatcaagcctcagttctttgccttccgatgg
ctgacattgctgctgtcccaggagttcttgctgcctgatgtcatccgtatctgggactcc
ctctttgctgatggcaaccgattcgatttcctcctcctggtctgctgtgctatgctcata
ctgatccgggagcagttactggagggggacttcactgtcaacatgcggcttctgcaggat
taccccatcacagacgtctgccagatcctacagaaagccaaggaactccaagactcgaag
taa

DBGET integrated database retrieval system