KEGG   Mus musculus (mouse): 70310Help
Entry
70310             CDS       T01002                                 

Gene name
Plscr3, 2210403O21Rik, 2610037N06Rik, ESTM3, X83310
Definition
(RefSeq) phospholipid scramblase 3
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Scramblase
Motif
Other DBs
NCBI-GeneID: 70310
NCBI-ProteinID: NP_001161969
MGI: 1917560
Ensembl: ENSMUSG00000019461
Vega: OTTMUSG00000006010
UniProt: Q9JIZ9 Q5F283
Position
11 B3; 11 42.9 cM
AA seq 296 aa AA seqDB search
MAGYLPPKGYAPSPPPPYPVPSGYPEPVALHPGPGQAPVPTQVPAPAPGFALFPSPGPVA
PGPPAPFVPLPGVPPGLEFLVQIDQILIHQKAERVETFLGWETCNMYELRSGTGQQLGQA
AEESNCCARLCCGARRPFRIRLADPGDREVLRLLRPLHCGCSCCPCGLQEMEVQAPPGTT
IGHVLQTWHPFLPKFSILDADRQPVLRVVGPCWTCGCGTDTNFEVKTKDESRSVGRISKQ
WGGLLREALTDADDFGLQFPVDLDVKVKAVLLGATFLIDYMFFEKRGGAGPSAITS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcaggctacttgccccccaaaggctatgccccttcacccccacctccctaccccgtg
ccatctgggtatccagagccggtggctctgcatcctggaccgggacaagctccagtgccc
acccaggtgcctgcccctgctcccggcttcgctctcttcccctcgccaggcccagtggct
ccagggcctcctgctcctttcgtgccattgccaggggtgcctcctggcctcgaattccta
gtgcagattgatcaaatcttgattcatcagaaggctgaacgagtggaaacgttcctaggc
tgggagacctgtaatatgtatgaacttcgctccggaaccggacagcaactgggtcaggca
gctgaagagagcaactgttgtgcccgcctgtgctgtggtgcccgccgaccatttcgaatc
cgcctagcggaccctggggaccgcgaggtgctccggctcctccgcccacttcattgtggc
tgcagctgctgcccctgtggtcttcaggagatggaagtccaggctccacctggcaccacc
attggccatgtgctacagacctggcatcccttccttcctaagttttccatcctggatgct
gatcgccaacctgttctacgagttgtagggccttgctggacttgtggctgtggtacagac
accaactttgaggtgaagactaaggatgaatcgcgaagtgtgggccgcatcagcaagcag
tggggagggctgctccgagaagccctcacagatgccgatgactttggcctccaattccca
gtcgatctagatgtgaaagtgaaggccgtactgctgggagccacgttcctcatcgattat
atgttcttcgagaagagaggaggcgcaggaccctctgccatcaccagttag

DBGET integrated database retrieval system