KEGG   Mus musculus (mouse): 70335Help
Entry
70335             CDS       T01002                                 

Gene name
Reep6, 0610011M24Rik, Dp1l1
Definition
(RefSeq) receptor accessory protein 6
  KO
K17279  receptor expression-enhancing protein 5/6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    70335 (Reep6)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   70335 (Reep6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TB2_DP1_HVA22
Motif
Other DBs
NCBI-GeneID: 70335
NCBI-ProteinID: NP_647453
MGI: 1917585
Ensembl: ENSMUSG00000035504
Vega: OTTMUSG00000000018
UniProt: Q9JM62
Position
10; 10 C1
AA seq 201 aa AA seqDB search
MDGLRQRFERFLEQKNVATEALGALEARTGVEKRYLAAGALALLGLYLLFGYGASLLCNV
IGFVYPAYASVKAIESPSKEDDTVWLTYWVVYALFGLVEFFSDLLLFWFPFYYAGKCAFL
LFCMTPGPWNGALLLYHRVIRPLFLKHHMALDSAASQLSGRALDLAAGITRDVLQALARG
RALVTPASTSEPPAALELDPK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggacggtctgcgccagcgcttcgaacgttttctggaacagaagaacgtggccaccgaa
gcgctcggggcgctcgaagcaaggaccggtgtagagaagcggtatctcgccgcgggagcc
ctcgcccttctaggcctgtatcttctgttcggttacggggcctctctactgtgcaatgtc
atcggatttgtataccccgcatatgcttcagtcaaagctatcgagagcccaagcaaggaa
gacgacactgtgtggctaacctactgggtggtgtacgccctgttcggtctggtcgaattc
ttcagcgatctactcctgttctggttccctttctactacgcgggcaagtgcgccttcctg
ttattttgcatgacgcccggaccctggaacggggcattactactataccatcgcgtcata
agaccactctttctaaagcaccacatggctctagacagcgccgcgagccagctaagcgga
agagcattggacctagcagctgggataacccgggacgtacttcaggccttggctcggggc
cgggctctcgtcaccccagcatcaacatcggaacccccagccgctctggaactggacccc
aagtaa

DBGET integrated database retrieval system