KEGG   Mus musculus (mouse): 70349
Entry
70349             CDS       T01002                                 

Symbol
Copb1, 2610019B04Rik, Cop
Name
(RefSeq) coatomer protein complex, subunit beta 1
  KO
K17301  coatomer subunit beta
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    70349 (Copb1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    70349 (Copb1)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    70349 (Copb1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   70349 (Copb1)
SSDB
Motif
Pfam: Adaptin_N Coatamer_beta_C Coatomer_b_Cpla Cnd1 HEAT HEAT_2 MMS19_N DUF5578 AP4E_app_platf
Other DBs
NCBI-GeneID: 70349
NCBI-ProteinID: NP_203534
MGI: 1917599
Ensembl: ENSMUSG00000030754
Vega: OTTMUSG00000060372
UniProt: Q9JIF7
Structure
PDB: 

Position
7 F1; 7 59.31 cM
AA seq 953 aa
MTAAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLM
TIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGRLLHEMILVCDAYRKDLQHPNEFIRGST
LRFLCKLKEAELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFEHLIPDAPELIHDF
LVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVQTFGDILQLVIVELIYKVCHANPS
ERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLI
VLDRLVELKEHPAHERVLQDLVMDILRVLSTPDLEVRKKTLQLALDLVSSRNVEELVIVL
KKEVIKTNNVSEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLSDSNEAAAADV
LEFVREAIQRFDNLRMLIVEKMLEVFHAIKSVKIYRGALWILGEYCSTKEDIQSVMTEVR
RSLGEIPIVESEIKKEAGELKPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEDRP
PLRGFLLDGDFFVAASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSL
PKKPITDDDVDRISLCLKVLSECSPLMNDIFNKECRQSLSQMLSAKLEEEKLSQKKESEK
RNVTVQPDDPISFMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLT
GFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPH
DFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEF
RQMWAEFEWENKVTVNTNMTDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSI
FGEDALANVSIEKPVHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTSL
NT seq 2862 nt   +upstreamnt  +downstreamnt
atgacggcagccgagaacgtgtgctatacgttaattaacgtgccaatggattcagaaccc
ccttcggaaatcagcttaaaaaatgacctggagaaaggcgatgtgaagtcaaagactgaa
gctttgaagaaagtgatcattatgattctgaatggggaaaagcttcccggactcctgatg
acaatcattcgcttcgtgctgcctcttcaggatcacaccatcaaaaagttgctcctggtc
ttctgggagattgttcctaaaacaactccagatggaaggctcttacatgaaatgattctt
gtgtgtgatgcatacagaaaggatctccagcaccccaatgagtttattcgtggatctact
cttcgtttcctttgcaaattgaaggaagcagaattgctggaacctttaatgcctgctatc
cgtgcgtgcttggaacatcgtcacagctatgttaggagaaatgctgttttggccatctat
accatctacagaaattttgaacatcttatacctgatgctcctgaactgatacatgatttt
cttgtgaatgagaaggatgcaagctgcaaaagaaatgcatttatgatgctaattcacgca
gatcaggatcgagctttggattatttaagtacatgtattgatcaagttcagacatttgga
gacattctacagttggttattgttgaactaatttataaggtctgtcatgctaatccatca
gaaagggcccgcttcattcgctgtatctataacttactgcagtcatctagtcctgctgta
aaatatgaggctgctgggacactggtaacactgtcaagtgcaccaactgcaataaaggct
gctgctcagtgttacattgatttaattattaaggagagtgataacaatgtaaagctcatc
gtcctggaccgcttggtggaattaaaagagcatcctgctcatgaacgagtcctgcaggat
ctggtcatggacatcctaagagtactgagtacgccagacttagaagtgcgtaagaaaacg
ctgcagttagcactggatcttgtctcatctaggaatgttgaagagttggttattgtctta
aagaaggaagtaattaaaacaaataatgtgtctgagcatgaagacactgacaaataccga
cagcttctcgtgcgaacactgcattcctgctctgtccgatttccagatatggctgcaaat
gttattcctgtgttaatggaatttctcagtgacagtaatgaagcagcagctgctgatgtc
ttagagtttgttcgtgaagccattcagcgctttgacaacctgagaatgctgattgttgag
aagatgctggaagtcttccatgctattaagtctgtcaagatttaccgaggagcattgtgg
atcctgggagagtactgcagtacaaaggaagacattcagagtgtgatgactgaggtccgc
aggtcccttggggagataccaattgtagaatcagaaataaagaaagaagctggcgagtta
aaaccagaagaagaaataactgttgggcccgttcagaaattggttacggagatgggcacc
tatgctactcagagtgcgctcagcagttccagacctaccaagaaagaagaagacagacca
cccttgagagggttcctcctggatggagatttctttgttgctgcttccctcgccacaact
ctaaccaagattgcattgcgctatgtagcgttggttcaggagaagaaaaagcaaaattct
tttgttgctgaggctatgttgcttatggcaactatccttcatttgggaaaatcctctctt
cctaagaagccaattactgatgatgatgtagatcgaatttccctgtgcctcaaggtctta
tctgaatgctcacctttaatgaatgacatctttaataaggagtgcagacagtctctttcc
caaatgttatctgccaaactcgaagaagagaaactatcccagaagaaagaatctgaaaag
agaaatgtgacagtacagcctgatgaccccatttccttcatgcaactaactgcgaagaat
gaaatgaactgcaaggaagatcagttccagctgagtttgttggcagcaatgggtaatact
cagaggaaagaggcagctgatcccctagcatccaaacttaacaaggtcactcagttgaca
ggcttctcggatccagtgtatgcagaagcctatgttcatgtcaatcagtacgacatcgtc
ctggatgttctggttgtaaaccaaaccagtgatactttgcagaactgcacattagagtta
gccactctaggggatctgaaacttgtggaaaaaccatctcctttgactcttgctcctcat
gactttgcaaatattaaagctaatgtcaaggtagcatcaacagaaaacggaataattttt
ggcaatatagtttatgatgtttctggagcagcaagtgacagaaactgtgtggtcctcagt
gacatccacattgacatcatggactatatccagcctgcaacttgcactgatgctgagttc
cgtcagatgtgggccgaatttgaatgggaaaataaagtgacagttaacaccaacatgact
gacctgaatgactacttacagcacatcctcaagtcgaccaacatgaagtgcctgactcca
gagaaggccctttctggatactgtggctttatggcagccaatctttatgcacgttctata
tttggagaggatgcacttgcaaatgtcagcattgagaagccagttcaccagggaccagat
gctgccgttactggccatataagaattcgtgcaaaaagtcagggaatggccttgagcctt
ggagataaaatcaacctgtctcaaaagaagactagtctataa

DBGET integrated database retrieval system