KEGG   Mus musculus (mouse): 70354
Entry
70354             CDS       T01002                                 

Symbol
Secisbp2l, 3110001I20Rik, AI504340, C630011I23
Name
(RefSeq) SECIS binding protein 2-like
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 70354
NCBI-ProteinID: NP_001355985
MGI: 1917604
Ensembl: ENSMUSG00000035093
Vega: OTTMUSG00000015342
Position
2; 2 F1
AA seq 766 aa
MEKNQAFSRGGRQTEQRNNLQVGFRCRGHSTSSERRQNLQKRQDNKHLNSTQSHRSDPNS
ESLYFEDEDGFQELSENGNSKDENIQQKLSSKVLDDLPENSPINIVQTPIPITTSVPKRA
KSQKKKALAAALATAQEYSEISMEQKKLQEALSKAAGKKTKTPVQLDLGDMLAALEKQQQ
AMKARQITNTRPLAHPVVTTATFHTKDSNRKTLAKSQPCVTSFNSLDITSSKAKKGKEKE
IAKLKRPTALKKVILKEREEKKGRLIVEHSVLGAEEPTETHLDLTNDLPQETVSQEDAGL
SMPSDASLSPASQNSPYCMTPVSQGSPASSGIGSPMASSTITKIHSKRFREYCNQVLSKE
IDECVTLLLQELVSFQERIYQKDPVRAKARRRLVMGLREVTKHMKLNKIKCVIISPNCEK
IQSKGGLDEALYNVIAMAREQEIPFVFALGRKALGRCVNKLVPVSVVGIFNYFGAESLFN
RLVELTEEARKAYKDMVAATEQEQAEEALRSVKTVPHHMGHSRNPSAASAISFCSVISEP
ISEVNEKEYETNWRSMVETSDGLEPSEMEKAAPCTHSPPEKPSRLALDTSLVGKQLPLAA
GSITSAPSQGKPTGDKDELKPDDLEWASQQSTETGSLDGSCRDLLNSSITSTTSTLVPGM
LEEEEDEEEEEEDYSHEPTAEEVQLNSRIESWVSETQRTMETLQLGKALPGSEEDSAEQS
GEEAAEVPEGLESGADSETWTPDQPPKPSSNMGKEHPDSSSPPQST
NT seq 2301 nt   +upstreamnt  +downstreamnt
atggaaaagaaccaagcattttctagaggtggaaggcaaactgaacaaagaaataattta
caggttggattcagatgcagagggcacagtacttcctcagaaagaagacagaatttgcaa
aagagacaagacaataagcacttaaactctactcagtctcacagaagtgacccaaattcc
gagtctttatattttgaggatgaagatgggtttcaagaactaagtgagaatggaaattct
aaagatgagaatattcaacagaaactttcttcaaaagtattggatgacttacctgagaac
tcacccatcaatatagttcagactccgattcccatcaccacctcagttcctaagcgagcc
aagagtcagaagaaaaaagcgttagctgcagcccttgctacagcacaggaatactcagaa
ataagtatggagcaaaaaaagttgcaggaagctctatcaaaagcagctggaaaaaagact
aaaacccctgtgcagctggacctaggggacatgctagctgctctggagaagcagcagcag
gcaatgaaggcacgccagatcaccaacaccaggccgctggcacatccagttgtcaccaca
gccactttccacactaaagactctaacagaaagaccttagccaaaagtcagccatgtgtg
acatcctttaattctttggatattacttcctctaaagcaaaaaaaggaaaagagaaggaa
attgcaaagctaaaacgacctacggcactgaaaaaggttattttgaaagaaagagaggag
aagaaggggcgtctgattgtggaacatagtgttttgggagccgaggagccaacagaaacg
catttggacctaaccaatgacttgcctcaggagactgtctcccaggaagatgctggactg
agcatgcccagtgatgcttcactttctccagcaagtcagaactctccatactgtatgaca
cctgtgtcgcaaggctcacccgctagttctggcataggcagcccaatggcatcgtcaacg
ataaccaaaatccacagcaaaagatttcgagaatattgtaaccaggttctttctaaagaa
attgatgaatgtgtgaccctccttctgcaagagcttgtcagtttccaggaacgcatctac
caaaaggacccagtgagagccaaggccaggcggcggctggtcatggggctgcgggaggtc
acaaagcacatgaagctgaacaagatcaagtgcgtcatcatttccccaaactgtgagaag
atccagtcaaaaggtggcctcgatgaagccctctacaatgttatagccatggcccgggag
caagagatcccttttgtgtttgcccttggaaggaaagctctgggacgctgtgtgaacaag
ctggttcccgttagtgttgtaggaatcttcaattattttggtgctgagagcctgtttaat
agattagtggagctcacagaggaagccaggaaggcgtataaagacatggttgcggcaaca
gagcaggagcaagcggaggaagccttgaggagcgtgaagacggtgcctcaccacatgggc
cactctcgcaacccctctgcagcaagcgccatttctttttgcagtgttatctctgaaccc
atttctgaagtcaatgaaaaggaatatgagactaactggaggagcatggtggagacgtcc
gacggcttggaaccgtcggaaatggagaaggcggctccctgcacgcacagccctcctgag
aagcccagcagactcgctcttgacaccagcctggtgggtaagcagctgccgctggctgca
ggcagcattacctcagcaccaagccagggcaaacccacgggtgacaaggatgagctgaag
ccagacgacctggagtgggcctcccagcagagcacagagaccggctccttggatggcagc
tgccgggatcttttgaactcctccatcaccagcaccaccagcactcttgtacctggcatg
cttgaagaagaggaggatgaagaggaggaggaggaggattatagtcatgagcccacagca
gaagaagtgcagctcaatagtagaatcgagtcctgggtctccgagacccagaggactatg
gagacactgcagcttggcaaagcccttcctggctcggaggaagacagtgcagagcaaagt
ggagaggaagcagcggaagtgcccgaagggctggagtcgggggcagacagtgagacctgg
actcccgaccagccgccaaagcccagcagtaacatgggcaaagagcaccctgattccagt
tctcctccccaaagtacataa

DBGET integrated database retrieval system