KEGG   Mus musculus (house mouse): 70357
Entry
70357             CDS       T01002                                 
Symbol
Kcnip1, KCHIP1, Kchip1.2
Name
(RefSeq) Kv channel-interacting protein 1
  KO
K23855  Kv channel-interacting protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    70357 (Kcnip1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  Calcium binding proteins
   70357 (Kcnip1)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 SPARC_Ca_bdg EF-hand_4 Troponin
Other DBs
NCBI-GeneID: 70357
NCBI-ProteinID: NP_001177814
MGI: 1917607
Ensembl: ENSMUSG00000053519
UniProt: Q9JJ57
Position
11:complement(33579339..33943854)
AA seq 227 aa
MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDELEMTMVCHRPEGLEQLEAQTNFT
KRELQVLYRGFKNECPSGVVNEETFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFE
DFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKED
TPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM
NT seq 684 nt   +upstreamnt  +downstreamnt
atgggggccgtcatgggcactttctcctccctgcagaccaaacaaaggcgaccctctaaa
gacatcgcctggtggtattaccagtatcagagagacaagattgaggatgagctagagatg
accatggtttgccaccggcctgagggactggagcagcttgaggcacagacgaacttcacc
aagagagaactgcaagtcttgtaccggggattcaaaaacgagtgccctagcggtgtggtc
aatgaagaaacattcaagcagatctacgctcagtttttccctcacggagatgccagcaca
tatgcacattacctcttcaatgccttcgacaccacccagacaggctctgtaaagttcgag
gactttgtgactgctctgtcgattttactgagagggacagtccatgaaaaactaaggtgg
acgtttaatttgtatgacatcaataaagacggctacataaacaaagaggagatgatggac
atagtcaaagccatctatgacatgatggggaaatacacctatcctgtgctcaaagaggac
actcccaggcagcatgtggatgtcttcttccagaaaatggataaaaataaagatggcatt
gtaacgttagatgaatttcttgaatcatgtcaggaggatgacaacatcatgagatctcta
cagctgttccaaaatgtcatgtaa

DBGET integrated database retrieval system