KEGG   Mus musculus (mouse): 70361
Entry
70361             CDS       T01002                                 

Gene name
Lman1, 2610020P13Rik, AI326273, AU043785, C730041J05, ERGIC, ERGIC53, F5F8D, MCFD1, MR6, MR60, P5, P58, gp5, gp58
Definition
(RefSeq) lectin, mannose-binding, 1
  KO
K10080  lectin, mannose-binding 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    70361 (Lman1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    70361 (Lman1)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    70361 (Lman1)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    70361 (Lman1)
Lectins [BR:mmu04091]
 L-type lectins
  70361 (Lman1)
SSDB
Motif
Pfam: Lectin_leg-like Bact_lectin Lectin_legB Golgin_A5 KxDL Cytochrom_B562 PRP1_N
Other DBs
NCBI-GeneID: 70361
NCBI-ProteinID: NP_001165533
MGI: 1917611
Ensembl: ENSMUSG00000041891
Vega: OTTMUSG00000030654
UniProt: Q9D0F3
Position
18; 18 E1
AA seq 517 aa
MAVSRRRVPQAGARSFFCALLLSFSQFTGSDGTGGDAAAPGAAGTQAELPHRRFEYKYSF
KGPHLVQSDGTVPFWAHAGNAIPSADQIRIAPSLKSQRGSVWTKAKAAFENWEVEVTFRV
TGRGRIGADGLAIWYTENQGLDGPVFGSADTWNGVGIFFDSFDNDGKKNNPAIVVIGNNG
QINYDHQNDGATQALASCQRDFRNKPYPVRAKITYYQKTLTVMINNGFTPDKNDYEFCAK
VENMVIPTQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTAEKDISEKEKEKYQEE
FEHFQQELDKKKEEFQKGHPDLQGQPADDIFESIGDRELRQVFEGQNRIHLEIKQLNRQL
DMILDEQRRYVSSLTEEISRRGAGTPGQPGQVSQQELDTVVKSQQEILRQVNEVKNSMSE
TVRLVSGIQHPGSAGVYETTQHFMDIKEHLHVVKRDIDSLAQRSMPSNEKPKCPDLPPFP
SCLSTIHFVIFVVVQTVLFVGYIMYRTQQEAAAKKFF
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggcggtgtccaggcggagggttccccaggctggagcgcggtcgttcttctgcgccctg
ctgctgtctttcagccaattcaccgggagcgacggcacgggaggcgacgctgcggctccc
ggcgccgcgggcacccaggccgagttgccacaccgccgtttcgagtacaaatacagcttt
aaggggccgcatctggtgcagagcgatgggaccgtgcccttttgggcccacgcggggaat
gctattccaagtgcagatcagattcgaatagcgccgtcattaaaaagccaaagaggttcc
gtgtggaccaaagcaaaagcagccttcgagaactgggaagtggaagtgacattccgagtg
accggaagaggtcgaattggagccgatggcttagcaatttggtatacagaaaatcaaggc
ttggacggccctgtgtttggatcagctgatacgtggaatggtgttggaatattttttgat
tcttttgacaatgatggaaagaaaaataatcctgctatagtagttataggcaacaatgga
caaatcaattatgaccatcaaaatgatggtgccactcaagctttagcgagttgtcagagg
gactttcgtaataaaccctatcctgtccgggcaaagattacgtattaccagaagacactg
acagtcatgatcaataatggctttacaccagataaaaatgattatgaattctgtgccaaa
gtggaaaacatggttatccccacacaaggtcattttgggatatcagcggcaacaggggga
cttgcagatgaccacgacgttctttctttcctgactttccaactgaccgagcctggaaaa
gagccacctacagcagaaaaagacatttcagaaaaagaaaaggaaaagtatcaagaggag
tttgagcacttccagcaagaattagacaagaagaaggaggaattccagaagggccaccct
gacctccaggggcagccagcggatgacatcttcgagagcataggcgatcgggagctgaga
caggtgtttgaaggacagaatcgtattcatctggagatcaagcagctgaaccggcagctg
gatatgattcttgatgaacagaggaggtacgtctcgtccctgacagaggagatctccagg
agaggagcaggaaccccgggacagcctgggcaggtctctcagcaggaactggacaccgtt
gtgaagagccagcaggagattctgagacaagtgaatgaggtgaagaactccatgagtgaa
actgtgcggctggtgagtggcatccagcacccgggctcagcaggcgtctacgagacaact
cagcacttcatggacatcaaggaacacctgcacgtggtgaagagagatatcgacagcctc
gcacagcgcagcatgccatctaatgaaaaaccaaaatgcccagacctaccaccattcccg
tcgtgtctatccacgatccactttgtgatatttgtagtggtgcagacagtgttgttcgtt
ggctatatcatgtacaggactcagcaagaagcagctgccaaaaaattcttttga

DBGET integrated database retrieval system