KEGG   Mus musculus (mouse): 70369
Entry
70369             CDS       T01002                                 

Symbol
Bag5, 1600025G07Rik, 4930405J06Rik, Bag-5
Name
(RefSeq) BCL2-associated athanogene 5
  KO
K09559  BCL2-associated athanogene 5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    70369 (Bag5)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  BAG
   70369 (Bag5)
SSDB
Motif
Pfam: BAG
Other DBs
NCBI-GeneID: 70369
NCBI-ProteinID: NP_001311409
MGI: 1917619
Ensembl: ENSMUSG00000049792
Vega: OTTMUSG00000028789
UniProt: Q8CI32
Structure
PDB: 
1UGO

Position
12; 12 F1
AA seq 447 aa
MDMGNQHPSISRLQEIQREVKAIEPQVVGFSGLSDDKNYKRLERILTKQLFEIDSVDTEG
KGDIQQARKRAAQETERLLKELEQNANHPHRIEIQNIFKEAQALVKDKIVPFYSGGNCVT
DEFEEGIQDIILRLTHVKTGGKVSLRKARYRTLTKICAVQEVIEDCMKKQPSLPLSEDVH
PSVAKINSVMCEVNKARGTLIALLMGVDSSETCRHLSCVLSGLIADLDALDVCGRTEIRN
YRREVVEDINKLLKYLDLEEEADSTHAFDLGQNHSIIKIENVLKRMREIKNELLQAQSPP
ELYLRAKTELQGLIGQLDEVSLEKNPCIREARRRAVIEVQILITYLDLKEALEKRKLFPC
EEHPPHKAVWEILGNLSEILGEVLSFGGNRTDKNYIRLEELLTKQLLALDAVDPQGEEKC
KAARKQAVKLAQNILSYLDMKSDEWEY
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggatatgggaaaccaacacccctccattagtaggcttcaggagatccagcgggaagta
aaggctatagagccgcaagtggtcggcttcagcggcctgtcggatgacaagaactacaag
aggctggagaggattctgaccaaacaactttttgaaattgactctgtggatacggaagga
aaaggagatatccagcaagctaggaagcgggcggcacaggagacagaacgtctcctcaag
gagttggagcagaatgccaaccacccacaccgcatcgaaatccagaatatctttaaggag
gctcaggcccttgtgaaagacaagattgtgcccttttacagcggaggcaactgtgtgact
gacgagtttgaggaaggcatccaggacatcattctgaggctgacgcacgtgaagaccgga
gggaaggtctccttgcggaaagccaggtaccgcacgctcaccaagatctgcgcggtacag
gaggttattgaggactgtatgaagaagcagccgtccctgccactgtctgaggatgtgcat
ccttcagtggccaaaatcaactctgtcatgtgcgaggtgaacaaggccagagggacgctg
atcgcacttctgatgggcgtggacagttccgagacttgcaggcacttatcctgcgtgctg
tcaggactgattgctgacttagatgctctagatgtgtgtgggcgtacagagatcagaaat
tatcggagggaggtggtggaagatatcaacaaattactgaaatacctagacttagaagag
gaagctgacagtacacatgcatttgacctgggacagaaccattccattataaaaatagaa
aatgttctcaagaggatgagagagataaaaaatgaacttctccaggcgcagagccctcct
gagttgtacctgagggccaagacagagctgcagggcttgatcggacagctggatgaagtg
agtctggagaaaaacccctgcatccgggaggccaggaggagggcggtgattgaggtgcag
atcctgatcacgtacctggacctgaaggaagccctcgagaagaggaagctgttcccatgt
gaggagcaccccccacacaaggccgtgtgggagatccttgggaacctgtctgagatcctg
ggcgaagtcctttcatttggtggaaaccgaactgataagaactacatccgtctggaggag
ctactgaccaaacagttgctggctctggatgccgttgacccacagggagaagagaagtgt
aaggctgccaggaaacaggctgtgaaactggcccagaacatcctcagctacctggacatg
aagtcggacgagtgggagtattga

DBGET integrated database retrieval system