KEGG   Mus musculus (mouse): 70373Help
Entry
70373             CDS       T01002                                 

Gene name
Gpatch2l, 1700020O03Rik, 4732487G21Rik, A630090I05Rik, Kiaa1152
Definition
(RefSeq) G patch domain containing 2 like
  KO
K17569  G patch domain-containing protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    70373 (Gpatch2l)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     70373 (Gpatch2l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 70373
NCBI-ProteinID: NP_081681
MGI: 1917623
Ensembl: ENSMUSG00000021254
UniProt: Q6PE65
Position
12; 12 D2
AA seq 482 aa AA seqDB search
MDELVHDLASALEQTSEQSKLGELWEEMALSPRQQRRQLRKRRGRKRRSDFTHLAEHACC
FSEASESSLDEATKDCREVAPLTNFSDSDDTVVAKRHPALSAIIRGKQHSWPESDSFTEN
APCRPLRRRRKVKRVTSEVAASLQQKLKVSDWSYERGCRFKSAKKQRLSRWKENTPWTSS
GHGLCESAENRTFLSQPGRKERMECEAEEQKHGSDENMSECDTSSVCSSSDTGLFTNDEG
RQGDDEQSDWFYEGECVPGFTVHNLLPKWAPDHCTEVERMDSGLDKLSDPTFLLPSRPAQ
RGYHGRLNRLPGAAARCLRKGRRRLPGKEASMSSLGTERIGHTISDPRQTDFWLPSAGKR
ERNQFNPLSPLYSLDVLADASHRRCSPAHCSARQASVHWGPPCPRDIKRKRKPVASASFS
SPSPVHPDVLEPAIPAQKPPDSEWLDGTSAAEKATAFPPATFFKMPQEKNSGCSSSPGTN
GC
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggatgagctagtgcatgacctggcctcagccttggagcagacatcggagcagagcaag
cttggtgagctgtgggaggagatggccctgagccccagacagcagaggcggcagcttcgc
aaacgccgaggacggaagcgccggtctgactttactcacctggcagagcacgcctgctgc
ttcagcgaggcctctgagtcaagtctggatgaagccaccaaggactgccgagaagtggct
ccgctcaccaacttcagtgactctgatgacacggtggtggccaaacggcacccagctctc
agtgccatcattaggggtaagcaacattcttggcccgagtctgactcctttacggaaaac
gcaccttgtcgacccctcaggcgccggcggaaggtgaagcgagtgacgtccgaggtggct
gccagccttcagcagaagctgaaagtgtcagattggagctatgagagaggctgcaggttc
aagtctgccaagaagcagcgtctatcccgctggaaggagaatactccctggacctcatct
ggccatgggctgtgtgaatcagcagagaatcggactttcctaagccaaccaggaaggaaa
gaaaggatggagtgcgaagccgaagagcagaagcacggctctgacgagaacatgtccgag
tgtgacactagcagtgtgtgcagcagcagtgacacggggctcttcaccaatgatgaagga
cgacaaggggatgatgagcagagtgattggttttatgaaggagaatgtgtccccggattc
actgtccataaccttctgcccaagtgggctcctgatcactgcactgaagtagaaaggatg
gactccggcctggataaactctcagaccccacgttccttttaccttcccggccagctcaa
agaggataccatggtcgtctgaataggttgccaggagctgcagctcgttgcctcaggaag
gggcggagaaggctgcctgggaaggaggcgagcatgagcagcctggggacggagaggatc
ggccataccatcagtgacccccggcagacagatttctggttaccatcagctgggaaaaga
gaacggaatcagtttaatccactctcccctctttactccctggacgttcttgctgatgct
tctcatcgaaggtgctcacctgcacactgctctgccaggcaggcaagtgtacactgggga
ccaccatgtccacgtgacattaagaggaaacggaaacctgtggcctcagcatctttttct
agccctagtccagtgcacccagatgttctggagccggccatcccagctcagaagcctcct
gactccgagtggttggacgggacctctgcagcagagaaagccactgcctttcctccagcc
acgtttttcaaaatgccacaggaaaagaattctggctgcagctctagcccaggaaccaat
gggtgttga

DBGET integrated database retrieval system