KEGG   Mus musculus (mouse): 70375
Entry
70375             CDS       T01002                                 

Symbol
Ica1l, 1700030B17Rik, Als2, Als2cr15, b2b3465C, b2b3465Clo
Name
(RefSeq) islet cell autoantigen 1-like
  KO
K19864  islet cell autoantigen 1-like protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    70375 (Ica1l)
SSDB
Motif
Pfam: Arfaptin ICA69
Other DBs
NCBI-GeneID: 70375
NCBI-ProteinID: NP_001303623
MGI: 1917625
Ensembl: ENSMUSG00000026018
Vega: OTTMUSG00000047263
UniProt: Q3TY65
Position
1; 1 C2
AA seq 431 aa
MDSSEQLRAEDNQSVVSRMQKNYWRTKQVFIKATGKKEDEHVVASDAELDAKLEVFHSIQ
ETCNELVKIVEKYQLRLNVISEEENELGLFLKFQAERDSTQAGEMMDAAGKALCSSAKQR
LALCTPLSRLKQEVATFSQRAISDTLVTINRMERARTEYRGALLWMKDASQELDPDTFKQ
MEKFRKVQNQVRNSKDSFDKLKKDVCQKVDLLGASRCNMLSHSLTTYQRTLLGFWEKTAQ
MMTQIQEACAGFHPYDFLALKRLQDTPGNLTADCTEGQTEGSCLTTDLNKVALSEEEEEE
RFEREPAVARALPRDSLEGDDFEKEFSFLNSLLSPTSSSASEFTQECQPACGSPCTGLTS
QEPSVGPGSLTSSSQFLPSQLFDLGLHADGAFNTPNNGNQDMSAWFNLFADLGPLSNPDA
IGHSDDELLNA
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggattcctctgagcaactcagagcagaagataaccagtcagtagtgagcagaatgcag
aagaactactggagaactaaacaagtctttatcaaagcgacgggaaagaaggaggacgag
catgtggttgcatccgatgcagaactggacgctaagttggaggtttttcactccatccag
gagacatgcaatgaacttgtgaagatagttgagaaataccagctaagactcaacgttata
tcagaggaagaaaatgaactaggactctttttaaagtttcaagcagagcgggattcgact
caagctggcgaaatgatggatgctgctggcaaggccctctgttcttcagccaagcaaaga
ttggccttgtgtactcccctgtctcgtcttaagcaagaagtggcaacattcagtcagagg
gccatttctgacaccttggtgaccattaaccgcatggagcgggcccgcacagagtacaga
ggagccctgctgtggatgaaagatgcatcgcaggaacttgacccagacaccttcaaacaa
atggaaaagttcagaaaagtacagaatcaagtgagaaacagcaaagattcttttgacaag
ttaaagaaggatgtctgccagaaagtggacttgctgggagctagtcgctgcaatatgctg
tctcactcactcactacctaccagagaacactgcttgggttctgggagaaaacagctcag
atgatgacccaaatccaagaggcctgcgctggctttcatccgtacgacttcctggctctc
aagcgactacaagacactccaggaaatctcactgcagactgcacagagggacaaacagaa
ggcagttgtctcactacagacctcaataaggtagctttgtctgaagaggaagaggaagag
agatttgaaagagaaccagcagttgcaagagctctgcctagagactcactagaaggagat
gattttgagaaagaattctcatttctgaacagcctcctaagccccacttcttcaagtgct
agtgagtttacacaggaatgccagcccgcgtgtgggagcccctgcactggcctcacatcc
caggagccttcagtaggacccgggtctctcacttcctcctcacagttccttccttcacag
ctctttgaccttggccttcacgctgatggagctttcaacacccccaacaatggtaaccaa
gacatgtcagcctggttcaatctatttgcagacttgggtccgctctcaaacccagatgcc
attggacactcagatgacgagcttctgaatgcctga

DBGET integrated database retrieval system