KEGG   Mus musculus (house mouse): 70394
Entry
70394             CDS       T01002                                 
Symbol
Kptn, 2310042D10Rik, 2E4, C030013F01Rik
Name
(RefSeq) kaptin
  KO
K23295  KICSTOR complex protein kaptin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    70394 (Kptn)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   KICSTOR complex
    70394 (Kptn)
SSDB
Motif
Pfam: FG-GAP FG-GAP_3
Other DBs
NCBI-GeneID: 70394
NCBI-ProteinID: NP_598488
MGI: 1890380
Ensembl: ENSMUSG00000006021
UniProt: G3X8R1
Position
7:15853801..15861441
AA seq 430 aa
MGEAAVAEGPCPLLEDSFTRFSSQSNVYGLAGGADGRGELLAATLKGKVLGFRYQDLRQK
IRPVAKELQFNYIPVDAEIVSIDTFNKSPPKRGLVVGITFIKDSGDKGSPFLNIYCDYEP
GSEYNLDSIAESCLNLELQFTPFQLCHAEVQVGDQLETVFLLSGNDPAIHLYKENEGLHQ
FEEQPVENLFPELTNLTSSVLWLDVHNLPGSSQRLSALGCQSGYVRVAHVDQKNQEILQT
WTIQQDGPISRVIVFSLSASEATQDSPQQEGYSLLVASMLEPAVVYWDLLNKGLDDQLLL
PGSDQFDSVLCGLVTDVDLDGQPEVLVATYGQELLCYKYRGLPEDSRGFRLLWRRSFASP
LLAMAHVDLTGDGLRELAVISLKGVHILQHSLIQASELVLTRLRHQVEQRKHQQGLGDRV
GPRPVEHPAS
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgggggaggcggccgtggcagagggaccttgtccactgctggaggacagcttcacgcgc
ttctcgtcgcaaagcaacgtgtacgggcttgctggaggcgcggacgggcgaggggagttg
ctggccgccactcttaaaggcaaggtgctcggcttccgctatcaagacctccgacagaaa
atccggcctgtggctaaagagctgcaattcaactacattcccgtggatgctgagatcgtc
tccatcgacactttcaacaagtcacccccaaaacggggcctggttgtgggcatcactttt
ataaaggactcaggagacaagggcagtccgtttcttaacatttactgtgactatgagcct
ggctcagagtacaacctggactctattgcagagagctgcctgaatttggaactccagttc
acacctttccagctgtgccacgcagaagtccaggttggggaccagctggagacggtgttt
ctgctgagtgggaacgatccagctattcatctctacaaggagaatgagggactacatcag
tttgaggagcagcccgtggaaaacctctttccagagctcacgaacctgaccagtagtgtc
ctttggcttgatgtccacaacctccctggctcatcccagcggctctcggctctcggctgc
cagagtggttatgtgcgtgtggctcacgtggaccagaagaatcaagagatcttgcagaca
tggacaatccagcaggatgggcccatctcccgagtgattgtgttcagcctgtcagcctcg
gaggcaacacaggacagcccccagcaggaaggatacagtctgcttgtggccagcatgctg
gagccagctgtggtgtactgggatcttctgaacaagggtctggatgaccaacttctcctg
cctggcagtgaccagtttgacagcgtcctctgtggcctggtcactgacgtggacctagat
ggacaaccggaagtcctggtggccacctatggacaggagctgctctgctataagtatcgt
ggactgccagaggacagcagaggcttccgcctgctgtggcgcaggagcttcgccagcccc
ctgctggccatggcccatgtggacctgactggagatggcctgcgggagctggccgtgata
tccctgaaaggggtgcacatcctccagcacagcctgatccaggcctctgaactggtcttg
acacggcttcgtcatcaagtggagcagaggaaacatcagcagggccttggggacagagtt
gggcccaggcctgtggaacacccagcctcctga

DBGET integrated database retrieval system