KEGG   Mus musculus (mouse): 70408
Entry
70408             CDS       T01002                                 

Gene name
Polr3f, 2810411G20Rik, 3010019O03Rik, 3110032A07Rik, RP, RPC, RPC39, RPC6
Definition
(RefSeq) polymerase (RNA) III (DNA directed) polypeptide F
  KO
K03025  DNA-directed RNA polymerase III subunit RPC6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    70408 (Polr3f)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    70408 (Polr3f)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    70408 (Polr3f)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     70408 (Polr3f)
SSDB
Motif
Pfam: RNA_pol_Rpc34 TrmB CDC24_OB1 TFIIE_alpha
Other DBs
NCBI-GeneID: 70408
NCBI-ProteinID: NP_084039
MGI: 1924086
Ensembl: ENSMUSG00000027427
Vega: OTTMUSG00000004234
UniProt: Q921X6 Q8C108
Structure
PDB: 
2DK8

Position
2; 2 G1
AA seq 316 aa
MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQRAVAINRLLSM
GQLDLLRSNTGLLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDIRYKSNLPL
TEINKILKNLESKKLIKAVKSVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFVEVL
NQQCFKFLQSKAETARESKQNPVIQRNSSFASSHEVWKYICELGISKVELSMEDIETILN
TLIYDGKVEMTIIAAKEGTVGSVDGHMKLYRAVNPILPPTGVVRAPCGLCPVFEDCHEGG
EISPSNCIYMTEWLEF
NT seq 951 nt   +upstreamnt  +downstreamnt
atggcggaggtgaaggtcaaggtgcagccgccggacgcggatccggtggagatagaaaac
agaattatagaattatgccaccagttccctcatggaatcacagatcaagtaattcagaac
gaaatgcctcacattgaagcccagcagcgggcagtggccatcaatagactgttatccatg
ggtcagttggatcttttaaggagtaacacaggcctcttatatagaataaaggattctcag
aatgctggtaaaatgaaggggtccgataaccaggaaaaactggtctatcaaatcatagag
gatgcagggaataaaggaatatggagcagagatattcggtacaaaagtaacttgccgtta
acagaaatcaacaaaattctcaagaatttggaaagtaaaaagctaattaaagccgtgaag
tctgtagcagcttccaaaaagaaggtttatatgctctataacctgcagccagaccgatct
gtgactggcggtgcctggtacagtgaccaggattttgaatctgaatttgttgaggtgctt
aatcaacagtgtttcaaattcctacaaagcaaggcagagacagcaagagaaagtaaacag
aatccagtgatacaaagaaatagttcatttgcatcgtcacatgaagtctggaagtacatc
tgtgagctgggcatcagcaaggtagagttgtccatggaggacattgaaaccatcttgaac
acactcatttatgatggcaaagtggagatgactatcattgctgcgaaggaaggcactgtt
ggcagcgtagatggacacatgaaactgtacagggcagtcaacccaatcctcccacctaca
ggcgtggtccgggcaccctgtggactctgccccgtttttgaggactgccatgaaggtggt
gagatttcgccgtctaattgtatttacatgacagagtggcttgaattttaa

DBGET integrated database retrieval system