KEGG   Mus musculus (house mouse): 70423
Entry
70423             CDS       T01002                                 
Symbol
Tspan15, 1110036D12Rik, 2700063A19Rik, AW048364, Tm4sf15
Name
(RefSeq) tetraspanin 15
  KO
K17297  tetraspanin-15
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    70423 (Tspan15)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   70423 (Tspan15)
SSDB
Motif
Pfam: Tetraspanin DUF2157 EMP70 DUF4199
Other DBs
NCBI-GeneID: 70423
NCBI-ProteinID: NP_932113
MGI: 1917673
Ensembl: ENSMUSG00000037031
UniProt: F7BWT7
Position
10:complement(62021175..62067055)
AA seq 294 aa
MPRGDSEQVRYCARFSYLWLKFSLIIYSTVFWLIGGLVLSVGIYAEAERQKYKTLESAFL
APAIILILLGVVMFIVSFIGVLASLRDNLCLLQSFMYILGICLVMELIGGIVALIFRNQT
IDFLNDNIRRGIENYYDDLDFKNIMDFVQKKFKCCGGEDYRDWSKNQYHDCSAPGPLACG
VPYTCCIRNTTDVVNTMCGYKTIDKERLNAQNIIHVRGCTNAVLIWFMDNYTIMAGLLLG
ILLPQFLGVLLTLLYITRVEDIILEHSVTDGLLGPGAKSRTDTAGTGCCLCYPD
NT seq 885 nt   +upstreamnt  +downstreamnt
atgcctcgcggggactcggagcaggtgcgctactgcgcgcgcttctcctatctttggctc
aagttctctctcatcatctactccaccgtgttctggctgattgggggcctggtcctgtca
gtggggatctacgcagaggcagagcggcagaaatacaaaaccctggagagtgccttcctg
gcccccgccatcatcctcatcctcctgggggtggtcatgttcatcgtctccttcatcggg
gtgctggcttccctccgggacaacctgtgccttctgcagtcgtttatgtatatcctgggg
atctgcctggtcatggagcttattggtggcatagtggctttgatcttccggaaccagact
attgactttctgaacgacaacatccggagaggaatcgagaattactacgatgatctggac
ttcaagaacatcatggactttgttcagaagaagttcaagtgctgtggcggggaggactac
agagactggagcaaaaaccagtaccatgactgcagcgcccccgggcccctggcctgcggg
gtgccctacacctgctgcatcaggaacacgacagatgttgtcaacaccatgtgtggctac
aaaacaatcgacaaggagcgcctgaatgcacagaacatcattcacgtgcggggctgcacc
aacgccgtgttgatatggttcatggacaactataccatcatggcgggccttttactgggc
atcctgcttcctcagtttcttggtgtgctgctgaccctactgtacatcacccgtgtggag
gacattatcttggagcactctgtcacggatggattgctgggacctggtgccaagtccaga
acggacacagcaggcactggatgctgcctgtgctatcccgattag

DBGET integrated database retrieval system