KEGG   Mus musculus (mouse): 70425
Entry
70425             CDS       T01002                                 

Gene name
Csnk1g3, 3300002K07Rik, C330049O21Rik
Definition
(RefSeq) casein kinase 1, gamma 3
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    70425 (Csnk1g3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    70425 (Csnk1g3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     70425 (Csnk1g3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   70425 (Csnk1g3)
SSDB
Motif
Pfam: Pkinase CK1gamma_C PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 70425
NCBI-ProteinID: NP_690022
MGI: 1917675
Ensembl: ENSMUSG00000073563
UniProt: Q8C4X2
Position
18; 18 D1
AA seq 424 aa
MDNKKKDKDKSDDRMARPSGRSGHSTRGTGSSSSGVLMVGPNFRVGKKIGCGNFGELRLG
KNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLG
PSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKAQQV
IHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFM
YFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKP
DYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQDPALSSNREAHQHRDKIQQS
KNQVVSSTNGELNTDDPTAGRSNAPITAPTEVEVMDETNCQKVLNMWCCCFFKRRKRKTI
QRHK
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggataataaaaagaaagacaaggacaaatcagatgatagaatggcacggcccagtggt
cggtcagggcacagcactcgaggaactgggtcttcttcatctggagttttaatggttgga
cctaactttagagttgggaaaaaaatcggatgtggcaattttggagaattacgattaggg
aaaaatttatacacaaatgaatatgtggcgattaaactggagcccatgaaatccagagca
ccacagctgcatttggaatacagattctataagcagttaggatctggagatggtatacct
caagtttactattttggcccttgtggtaaatacaacgcgatggtgctggaactgctggga
ccgagtttggaggatttgtttgacctctgtgatagaacattttctcttaaaacagttctc
atgatagctatacagctgatttctcgtatggagtatgtccactcaaagaacttgatatac
agagatgtgaagcctgagaacttcttaataggacggccaggaaacaaagcccagcaagtc
attcatatcatagattttggtttggcaaaggaatatattgatccagagacaaagaaacat
ataccatacagagaacacaaaagccttaccggaaccgccagatacatgagcataaacaca
catctaggaaaagagcagagtagaagagatgatttagaagccttaggccacatgttcatg
tacttcctgagaggcagtcttccttggcaaggcttaaaggctgacacattaaaagagagg
tatcagaaaattggagacacaaaacgagccacaccaatagaagtgttgtgtgagaacttc
ccagaagaaatggcaacgtatctccgttacgtacgaaggctggatttttttgaaaagcca
gactatgattacctaagaaagctttttactgacttgtttgatcgaaaagggtatatgttt
gattatgaatatgactggattggtaaacagttgcctactccagtaggtgcagttcagcaa
gaccctgctctgtcatcaaacagagaagcacaccaacacagagataagatacagcagtct
aaaaaccaggttgtaagttctacaaatggagagctgaacacggatgaccccacggcagga
cggtcgaatgcacccattacagctcctacagaagtggaagtgatggacgagacaaactgc
cagaaagtattgaatatgtggtgctgctgttttttcaaacgaaggaaaaggaaaaccata
caacgtcacaaatga

DBGET integrated database retrieval system