KEGG   Mus musculus (mouse): 70428
Entry
70428             CDS       T01002                                 

Gene name
Polr3b, 2700078H01Rik, A330032P03Rik, C128, C85372, RP, RPC2
Definition
(RefSeq) polymerase (RNA) III (DNA directed) polypeptide B
  KO
K03021  DNA-directed RNA polymerase III subunit RPC2 [EC:2.7.7.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    70428 (Polr3b)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    70428 (Polr3b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    70428 (Polr3b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     70428 (Polr3b)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     70428 (Polr3b)
SSDB
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_7 RNA_pol_Rpb2_2 RNA_pol_Rpb2_4 RNA_pol_Rpb2_3 RNA_pol_Rpb2_5
Other DBs
NCBI-GeneID: 70428
NCBI-ProteinID: NP_081699
MGI: 1917678
Ensembl: ENSMUSG00000034453
Vega: OTTMUSG00000063526
UniProt: P59470
Position
10; 10 C1
AA seq 1133 aa
MDVLAEEFGSLTPEQLTAPIPTVEEKWRLLPAFLKVKGLVKQHIDSFNYFINVEIKKIMK
ANEKVTSDADPMWYLKYLNIYVGLPDVEESFNVTRPVSPHECRLRDMTYSAPITVDIEYT
RGSQRIIRNALPIGRMPIMLRSSNCVLTGKTPAEFAKLNECPLDPGGYFIVKGVEKVILI
QEQLSKNRIIVEADRKGAVGASVTSSTHEKKSRTNMAVKQGRFYLRHNTLSEDIPIVIIF
KAMGVESDQEIVQMIGTEEHVMAAFGPSLEECQKAQIFTQMQALKYIGNKVRRQRMWGGG
PKKTKIEEARELLASTILTHVPVKEFNFRAKCIYTAVMVRRVILAQGDNKVDDRDYYGNK
RLELAGQLLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVNAIS
TGNWSLKRFKMDRQGVTQVLSRLSYISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLC
PSDTPEGEACGLVKNLALMTHITTDMEDGPIIKLAGNLGVEDVNLLCGEELSYPNVFLVF
LNGNILGVIRDHKKLVSTFRLMRRAGYINEFVSISTNLTDRCVYISSDGGRLCRPYIIVK
KQKPAVTNKHMEELAQGYRNFEDFLHESLVEYLDVNEENDCNIALYEHTINKDTTHLEIE
PFTLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQKPMV
KTKTIELIDFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLK
RYTNQTFDKVMGPMLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPL
EGSNVPQQPQYKDVPITYKGATDSYIEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSR
HGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHY
GTAFGGSKVKDVCEDLVRHGYNYLGKDYVTSGITGEPLEAYIYFGPVYYQKLKHMVLDKM
HARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMISSDAFEVDVC
GQCGLLGYSGWCHYCKSSCHVSSLRIPYACKLLFQELQSMNIIPRLKLAKYNE
NT seq 3402 nt   +upstreamnt  +downstreamnt
atggatgttctagccgaggagttcgggagcctgactccggagcagctgactgcgccgatc
ccgactgtggaggaaaaatggaggctgcttccagcatttttaaaggttaaaggcctggtg
aaacagcacatagactcctttaactatttcattaatgtagagataaagaagataatgaaa
gccaatgaaaaggttacaagtgatgctgaccccatgtggtacttaaaataccttaatatc
tatgtcggacttcctgatgttgaagaaagcttcaatgtaactagaccagtgtcccctcat
gagtgccgtctgagggacatgacgtactccgccccaatcacagtggacattgagtatacc
cgaggcagccagaggataatccgcaacgccttacccattggcagaatgcccatcatgctc
cgaagctcgaactgtgttctaacagggaaaacgccggcagagtttgccaaactgaatgag
tgtccactagacccaggtggctacttcattgttaaaggagtggaaaaagtcattcttatc
caagagcagctgtccaagaacaggatcattgtggaggccgacaggaaaggagccgttgga
gcctcagttaccagctccacccatgagaagaaaagcagaaccaacatggccgtgaaacag
ggtcgattctatctgaggcacaacaccctgtctgaagatatccccattgtcatcatattt
aaggccatgggtgtggagagtgaccaggaaatcgtgcagatgattggaacagaggagcac
gtgatggctgcatttgggcccagcttggaggagtgccagaaagctcagatcttcacccag
atgcaggcattgaagtatatagggaataaagtaagaagacaaagaatgtggggaggtgga
ccaaagaaaaccaaaatagaagaagcaagagaactcctggcttctaccattctgacccac
gtaccagtgaaggaattcaatttccgagctaagtgtatctacactgcagtgatggtgcga
agggtgatcctggcccaaggagataacaaggtcgatgacagagactattatggcaacaaa
cgactggaattggcaggacagctcttatctcttctttttgaagatttgtttaaaaagttt
aattcagaaatgaagaagattgcagaccaagtgattcctaaacagagagcagcccagttt
gacgtcgttaaacacatgcgccaagaccagattaccaacggcatggtcaatgccatctcc
acgggaaattggtctctgaagagatttaagatggaccgacagggtgtgacccaggtgctg
tctcgcttgtcatatatatctgcactcggcatgatgacaagaatctcttcccagtttgaa
aagacgaggaaagtgagtggccctcgttctctgcagccgtctcagtggggaatgctctgt
ccctccgacacacctgaaggggaggcctgtggtttggttaagaacttggccctcatgaca
catataacaactgacatggaagatggacccattattaagttagctgggaacttgggagta
gaagatgtgaatttattatgtggagaagagctctcttacccaaatgtgtttcttgtcttc
ctgaatggtaacatccttggtgtcattcgagaccataaaaagcttgtcagcacattccgg
ctgatgcgaagagcaggctatatcaatgaatttgtttctatctccacaaaccttacggat
cgctgtgtttatatttcctctgatggcgggcgcttgtgcaggccttacataattgttaag
aaacaaaagccagctgtcacaaataagcacatggaagagttggctcaaggctacaggaat
tttgaagatttcttacatgaaagtctagttgaatacttagatgtgaatgaagaaaatgac
tgtaacattgcgctctacgaacatacaattaataaagacaccacccacttggagattgaa
cccttcactctgcttggtgtttgtgccggcctgatcccataccctcatcacaaccagtct
ccaagaaacacctaccagtgtgctatgggcaagcaagccatgggtaccattggctacaat
caacggaacagaattgatacacttatgtatctactagcatatccacaaaagcccatggtt
aaaacaaaaacaatcgagttgatagattttgagaagttgccggctggccagaacgcaact
gttgccgtgatgagctacagcggctatgacattgaggacgcgctggttttgaacaaggcc
tctctggacagaggttttgggcgttgtcttgtgtataaaaatgctaagtgcaccttgaaa
cgatacaccaatcagacctttgataaggtgatgggtcccatgttggatgctgctaccaga
aaacccatctggcgacatgaaattttagatgcagatggcatttgttctccaggtgagaaa
gtggaaaacaaacaggtgcttgtaaacaagtccatgcccacagtgacacagattcctttg
gaagggagcaacgtgccacagcaaccacagtataaagatgtgcctatcacgtacaaaggt
gcgacagactcctacatcgagaaagtgatgatctcttccaacgccgaggatgctttcctc
atcaagatgctcctgagacagacgcggcgcccagagattggagacaaattcagcagtcgc
catggacaaaagggtgtctgtggcctgatcgtcccccaggaagacatgccgttctgtgat
tctggcatctgtcccgacatcataatgaacccacacggcttcccatcaagaatgacggtt
ggaaagttaattgagctgctggctggcaaggcaggcgtgttagacggcaggttccactac
ggcactgcctttggagggagtaaagtgaaggatgtgtgtgaagatctcgttcgccatggt
tacaactacctggggaaggactacgtcacctcaggcatcacaggtgagcccttagaagca
tacatctattttggacctgtgtattatcagaaactgaaacacatggtgctggataaaatg
cacgcccgggcccgaggaccacgagctgtccttaccaggcagcccactgaagggcggtcg
cgcgatggtggcttgcgacttggagaaatggaacgcgactgtctaatcggctatggagcg
agtatgcttttgctggagagactaatgatctcaagtgatgcctttgaggttgacgtctgc
gggcagtgtggactcctgggatattctggctggtgccactactgcaaatcttcgtgccac
gtgtcctccctccgcatcccgtatgcctgcaagctgctcttccaggagttacagtccatg
aacatcatccccaggctgaaactggccaagtacaacgagtaa

DBGET integrated database retrieval system