KEGG   Mus musculus (mouse): 70435
Entry
70435             CDS       T01002                                 

Gene name
Inf2, 2610204M08Rik, AA589465, AW125550, EG629699
Definition
(RefSeq) inverted formin, FH2 and WH2 domain containing
  KO
K23958  inverted formin-2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    70435 (Inf2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  Formin homology (FH) domain-containing proteins
   70435 (Inf2)
Motif
Pfam: FH2 Drf_FH3 Drf_GBD WH2 Mgr1 MMTV_SAg
Other DBs
NCBI-GeneID: 70435
NCBI-ProteinID: NP_940803
MGI: 1917685
Ensembl: ENSMUSG00000037679
UniProt: Q0GNC1 E9QLA5
Position
12; 12 F1
AA seq 1271 aa
MSVKEGAQRKWAALKEKLGPQDSDPTEANLESAEPELCIRLLQMPSVVNYSGLRKRLESS
DGGWMVQFLEQSGLDLLLEALARLSGRGVARISDALLQLTCISCVRAVMNSQQGIEYILS
NQGYVRQLSQALDTSNVMVKKQVFELLAALCIYSPEGHALTLDALDHYKMVCSQQYRFSV
IMSELSDSDNVPYVVTLLSVINAIILGPEDLRSRAQLRSEFIGLQLLDILTRLRDLEDAD
LLIQLEAFEEAKAEDEEELQRISDGINMNSHQEVFASLFHKVSCSPASAQLLSVLQGLMH
LEPAGRSGQLLWEALENLVNRAVLLASDAQACTLEEVVERLLSIKGRPRPSPLDKAHKSV
QTNSVQNQGSSSQNTTTPTTKVEGQQPVVASPCQHVGSIQSSSVDIAPQPVALEQCITAL
PLPTPPLSSSTPVLPPTPPPLPGPGATSPLPPPPPPLPPPLPGSGTTSPPPPPPPPPPLP
PPLPGSGTISPPPPPPPPPLPGTGAVSPPPPPPLPSLPDSHKTQPPPPPPLPGMCPVPPP
PPLPRAGQIPPPPPLPGFSVPSMMGGVEEIIVAQVDHSLGSAWVPSHRRVNPPTLRMKKL
NWQKLPSNVARERNSMWATLGSPCTAAVEPDFSSIEQLFSFPTAKPKEPSAAPARKEPKE
VTFLDSKKSLNLNIFLKQFKCSNEEVTSMIQAGDTSKFDVEVLKQLLKLLPEKHEIENLR
AFTEERAKLSNADQFYVLLLDIPCYPLRVECMMLCEGTAIVLDMVRPKAQLVLTACESLL
TSQRLPVFCQLILKIGNFLNYGSHTGDADGFKISTLLKLTETKSQQSRVTLLHHVLEEVE
KSHPDLLQLSRDLEPPSQAAGINVEIIHSEASANLKKLLEAERKVSASIPEVQKQYAERL
QASIEASQELDKVFDAIEQKKLELADYLCEDPQQLSLEDTFSTMKTFRDLFTRALKENKD
RKEQMAKAERRKQQLAEEEARRPRDEDGKPIRKGPGKQEEVCVIDALLADIRKGFQLRKT
ARGRGDTEASGRVAPADPPKATEPATASNPTQGTNHPASEPLDTTAADEPQGWDLVDAVT
PSPQPSKEEDGPPALERRSSWYVDAIDFLDPEDTPDAQPSEGVWPVTLGDGQALNPLEFS
SNKPPGVKSSHQDATDPEALWGVHRTEADSTSEGPEDEAQRGQSTHLPRTGPGEDEDGED
TAPESALDTSLDRSFSEDAVTDSSGSGTLPRVQGRVSKGTSKRRKKRPSRNQEEFVPDSD
DIKAKRLCVIQ
NT seq 3816 nt   +upstreamnt  +downstreamnt
atgtctgtaaaggaaggcgctcaacgcaagtgggcggcgctgaaggagaagctggggccg
caggactcagaccccacggaagccaacctggagagcgccgagcctgagctgtgcatccgg
ctgctgcagatgccctcggtggtcaactactcgggcctgcgcaagcgcctggagagcagc
gatggcggctggatggtgcagttcctggagcagagcggcctggacctgctgctggaggcg
ctggcacggctgtcagggcgtggcgtggcccgcatctcggatgccctgctgcagctcacc
tgcatcagctgtgtgcgtgctgtcatgaattcacagcagggcatcgaatacatcctcagc
aaccagggttatgtgcgccagctctcccaggctctggatacctccaatgtaatggtcaag
aagcaggtgtttgaattgctggctgctctgtgcatctattcgcctgagggccacgcactg
acgctcgatgccctggaccattacaagatggtgtgcagccagcagtaccgcttcagcgtc
atcatgagtgagctctcggacagtgacaacgtgccctatgtggtcaccctgctcagtgtg
atcaacgccatcattctgggtcccgaggacctccgctctcgtgcccagctgcggagtgag
ttcatagggctacagctgctggatattctgacccggctacgagacttggaggatgcggat
ctgctgatccagctggaagccttcgaagaggccaaagcggaggacgaggaggaacttcag
cgaattagcgatgggatcaacatgaacagccaccaggaagtctttgcgtccctgttccac
aaggtgagctgttctccagcgtcggcccagctgctgtcagtattgcagggtctcatgcac
ctggagcctgctggccgctcaggccaactgctctgggaggccctggaaaacctggtgaac
cgggctgtgctcctggccagtgatgcccaggcttgcaccctggaggaggtggttgaacga
ctgctgtccatcaaagggcggccccgaccaagccccctggacaaggcccacaagagtgtc
cagaccaactcagtccagaatcagggcagttcctcccaaaacactactactcccacaact
aaagtggaaggccagcagccagtagtggcttctccctgccaacacgtgggcagcatccag
agctccagtgttgacatagcgccacagccagtagcccttgagcagtgcataacagcctta
cctctacctaccccaccactctccagctccacccctgtgctccctccaaccccacccccc
ctgccaggcccaggggccacatctccccttccccctccccctccccctttgcctccccct
ttgccaggctcagggaccacatctccccctccccctcctcctccccctccccccttgcca
ccccctctgccaggctcagggaccatatctccccctccacccccacccccacctccccta
ccaggtacaggggctgtgtctcccccaccccctccgccacttccatctctgcctgattcc
cacaagacccagcccccgcccccacccccactccctggcatgtgcccagttcctccccct
cccccactacccagagcaggccagatacctccacctcctcccctgcctggtttctctgtc
ccctccatgatgggtggtgtggaggagatcattgtggcccaggtcgaccacagcctgggc
tcagcctgggtccccagtcaccgcagagtgaatccacccacactgagaatgaagaagctg
aactggcagaagctgccatccaatgtggcacgagagcgcaactccatgtgggccacactg
ggcagcccctgcacagccgcagtggagcccgacttctccagcattgagcagctgttctcc
ttccccacggctaagcccaaggagccctctgctgcccccgccaggaaggagcccaaagaa
gtcacttttctggactccaagaagagcctgaacctcaacatcttcctgaagcaatttaaa
tgttccaatgaagaagtcaccagcatgatccaggctggagacaccagcaagtttgatgtg
gaggtcctcaaacagcttctaaagcttcttccagagaagcatgagattgagaacctacgg
gcgttcactgaggagcgagccaagttgtccaatgctgaccagttctatgttctgctcctg
gacattccctgctacccgctgcgggtggagtgcatgatgctgtgtgagggaacggccatc
gtcctggacatggtgcggcccaaggcccagctggtgctcactgcctgcgagagcctgctc
accagccagcggttgccagtcttctgtcagctgatcctcaaaatcgggaatttcctcaac
tacggcagccacacgggagatgcagatggtttcaagattagcaccttgctgaagctcaca
gagaccaagtcccagcagagtcgcgtgacgctgctgcaccacgtgctggaggaagtggag
aagagccacccggacctcctacagctatcccgggacctggagccaccctctcaagctgca
ggaatcaacgtggagatcatccactcagaggccagtgccaacctgaagaagcttctagaa
gcggagcggaaggtgtccgcttccatccctgaggtgcagaagcagtacgctgagcgcctc
caggccagcattgaggcctctcaggagctggacaaggtattcgacgccattgagcaaaag
aaactggagctggctgactacctgtgcgaagacccccagcagctgtccctagaggacacg
ttcagcaccatgaagaccttccgagacctcttcacccgtgccctgaaggagaacaaggac
cggaaggaacagatggcaaaagcggaaaggaggaaacagcagctggcggaggaggaggcc
cggaggccgagggacgaggatgggaagcctatcaggaaggggcctgggaagcaagaagag
gtgtgcgtcatcgatgccctgctggccgacatcaggaagggcttccagctacggaagaca
gcccggggccggggagacactgaagcaagtggcagagtggcccccgcagatcctccaaag
gccacagagcctgcaactgccagcaatcctacccagggcacaaaccaccctgcttcagag
cccttggataccacagcagctgacgagccgcagggctgggaccttgtggatgctgtaacc
cccagcccccagccctccaaggaggaagatggtcctccagccctggagaggcgctcctcc
tggtatgtggatgccattgacttcctggaccctgaagataccccggatgcccagccctct
gagggggtctggccagtgactctgggagatggtcaagctctgaatcccctcgagttctct
agcaataagcctcctggagtcaagagctcgcaccaggacgctacggatcctgaagccttg
tggggcgtccaccgaaccgaggcagacagcaccagtgagggaccagaggatgaagctcag
cgaggacagagcacccacctaccccgcacaggccccggagaggatgaggatggagaggac
acagccccagaatctgcacttgacacgtccctggacaggtccttctctgaggacgcagtg
acagattcctcagggtctggcaccctccccagggtccaaggccgggtctcaaaggggacg
agcaagcggaggaagaaacgtccctcaaggaaccaagaagagtttgtccctgattctgat
gatattaaggcaaaaaggctgtgtgtgatccagtga

DBGET integrated database retrieval system