KEGG   Mus musculus (mouse): 70439
Entry
70439             CDS       T01002                                 

Symbol
Taf15, 2610111C21Rik, 68kDa, TAFII68, Taf2n
Name
(RefSeq) TATA-box binding protein associated factor 15
  KO
K14651  transcription initiation factor TFIID subunit 15
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03022  Basal transcription factors
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    70439 (Taf15)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    70439 (Taf15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    70439 (Taf15)
   03019 Messenger RNA biogenesis [BR:mmu03019]
    70439 (Taf15)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     70439 (Taf15)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     70439 (Taf15)
SSDB
Motif
Pfam: RRM_1 zf-RanBP
Other DBs
NCBI-GeneID: 70439
NCBI-ProteinID: NP_081703
MGI: 1917689
Ensembl: ENSMUSG00000020680
Vega: OTTMUSG00000000917
UniProt: Q8BQ46
Position
11; 11 C
AA seq 557 aa
MSDSGSYSQSGGEQQSYSSYGNQGSQGYGQTPQGYSGYGQTTDSSYGQNYGGYSGYGQNQ
SGYSQSYGSYENQKQSSYGQQSYNNQGQQNTESSGGQGGRAPSYGQSDYGQQDSYDQQSG
YDQHQGSYDEQSNYQQHDSYNQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGSQG
GGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRPDADSESDNSDNNTIFVQGLG
EGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDW
FDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKNGDWVCPN
PSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGGDR
SGGGYGGDRSGGGYGGDRGGSYGGDRGGYGGDRGGSYGGDRGGYGGDRGGYGGDRGGYGG
DRGGYGGDRGGYGGDRSRGAYGGDRGGSGSGSGGYGGDRSGGYGGDRSGGYGGDRGGYGG
KMGGRNDYRNDQRNRPY
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgtcggattctggaagttacagtcagtctgggggtgagcagcaaagttattcttcttat
ggaaatcaaggcagtcaaggctatggacaaacaccacaaggttattctggctatgggcaa
acgactgattcttcgtatggacaaaactatggtggttactccggttatggacaaaatcaa
tcaggttattcacagtcgtatggtagttatgagaatcaaaagcagagttcatatggccag
caatcatacaataaccagggacaacaaaacacggagtcatcaggaggtcaaggtggaaga
gcaccttcatatggccagtcagactatggtcagcaagattcttatgaccagcagtcaggt
tatgatcagcatcaaggctcatatgatgagcagtccaattatcagcaacatgattcctat
aatcaaaaccaacagtcttaccattcacaaagggaaaactacagccaccacacacaagat
gaccgtcgtgatgtgagtaggtatggagaagataatagaggatatggcgggtcacaggga
ggaggtagagggcgtgggggatatgacaaggatggaagaggtcctatgacaggatcaagt
ggtggtgaccgcggtggcttcaaaaattttggtggtcacagggattatggacccagacca
gatgctgattcagagtctgataattcagataacaacacaatctttgtgcaaggacttggg
gagggtgtgtctacagatcaagtgggagagttctttaagcaaataggaattatcaagact
aacaaaaagactggaaaaccaatgataaatctttacacagacaaagacacaggaaagcca
aaaggggaagcaacagtgtcatttgatgaccctccatcagctaaggcagccattgattgg
tttgatggaaaagaattccatggaaacatcataaaagtgtcatttgccactagaaggcct
gaatttatgagaggtggtggaagtggaggtggacgccgaggccgtggaggatatagaggc
cgtggaggttttcaggggcgaggtggagaccccaagaatggggactgggtttgccctaat
ccgtcatgtggaaatatgaactttgctcgaagaaactcctgtaatcagtgcaatgagcct
agaccagaggactcacgtccctcagggggagatttccgggggagaggctatggtggagaa
aggggctacagaggtcgtgggggcagaggtggagaccgaggtggctatggtggagacaga
agtgggggaggttatggtggagacaggagtgggggtggctatggtggggatagaggaggt
agctatggaggagacagaggtggttatggtggggaccgaggaggcagctatggaggagac
cgaggtggctacggaggagacagaggtggctatggaggagacagaggtggctatggaggt
gatcgaggaggctatggaggtgatcgaggtggatatggaggagaccgcagccggggggcc
tatggaggagaccgtggtggtagtggtagtggcagtggaggctacggtggagacagaagt
ggaggctacggtggagaccgaagtggtggctacggaggagaccgaggtggctatggaggc
aaaatgggaggaagaaacgactacagaaatgatcagcgcaaccgaccatactga

DBGET integrated database retrieval system