KEGG   Mus musculus (mouse): 70450Help
Entry
70450             CDS       T01002                                 

Gene name
Unc13d, 2610108D09Rik, Jinx, Munc13-4, mFLJ00067
Definition
(RefSeq) unc-13 homolog D
  KO
K19728  protein unc-13 D
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    70450 (Unc13d)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    70450 (Unc13d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2 Membr_traf_MHD DUF5376
Motif
Other DBs
NCBI-GeneID: 70450
NCBI-ProteinID: NP_001009573
MGI: 1917700
Ensembl: ENSMUSG00000057948
Vega: OTTMUSG00000003687
UniProt: B2RUP2 Q80UG7
Position
11; 11 E2
AA seq 1083 aa AA seqDB search
MATHLSHPQRRPLLRQAIKIRRRRVRDLQDPPPQATQEVQVQSHHFSPEERDLLYEEALY
TVLHRLGQPEPNHVKEASELLSYLQEAFQVQPEEHQQMLRRVRELEKPVFCLKATVKQAK
GILGKDVSGFSDPYCLLGIEQKVGVAEGSPVSRRRQKAVVKHTIPEEETHRTQVKSQTLN
PVWDETFILEFEDIANASFHLDMWDLDTVESVRQKLGELTDLHGLRRIFKEARKDKGQDD
FLGNVVLRLQDLRCREDQWFPLEPCTETYPDRGQCHLQFQFIHKRRATAASRSQPSYTVH
FHLLQQLVSHEVTQHQAGSTSWDASLSPQAVTILFLHATQKDLSDFHQSMAQWLAYSRLY
QSLEFPSSCLLHPITSIEYQWIQGRLKAEQREELATSFTSLLAYGLSLIRKFRSVFPLSV
SDSPSRLQSLLRVLVQMCKMKAFGELCPDSAPLSQLVSEALRMGTVEWFHLMQQHHQPMG
ILEAGKALLNLVQDVMGDLYQCRRTWNKIFHNVLKIDLFSMAFLELQWLVAKRVQDHTVA
AGNLVSPDIGESLFQLYVSLKELCQLGPVPSDSREVLALDGFHRWFQPAIPSWLQKTYSV
ALERVQRAVQMDTLVPLGELTKHSTSAVDLSTCFAQISHTARQLDWPDPEEAFMITVKFV
EDTCRLALVYCSLIKARARELSAVQKDQSQAADMLCVVVNNMEQLRLIIDKLPTQLAWEA
LEQRVGAVLEEGQLQNTLHAQLQGALAGLGHEIRTGVRTLAEQLEVGIATHIQKLIGVKE
SVLPEDAILPLMKFLEVKLCYMNTNLVQENFSSLLTLLWTHTLTVLVEVASSQRSSSLAS
GRLKVALQNLEVCFHAEGCGLPPEALHTDTFQALQNDLELQAASSRELIQKYFCSRIQQQ
AETTSERLGAVTVKVSYRASEQRLRVELLSASSLLPLDSNGSSDPFVQLTLEPRHEFPEV
APRETQKHKKELHPLFDETFEFLVPAEPCQKAWACLLLTVLDHDRLGADDLEGEAFLPLC
RVPGLTDCAEPGEAPQMRLPLTYPAPNGDPILRLLESRKGDREAQAFVKLRRQRAKQASQ
HAP
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atggcgacacacctttcccacccccagcggcgtccactcttgcgccaggccatcaagata
aggcgccgcagggtcagagacctgcaggatccaccaccccaagccacccaggaggtccag
gttcagtcccaccatttctccccagaggagcgggacctgctgtatgaggaagccctctat
actgtcctgcaccgcctgggtcagccagagcccaaccatgtgaaggaggcctcggaactg
ctgagctatctgcaggaggctttccaggtgcagcctgaggagcaccagcagatgctgcgg
cgcgtcagggagctcgagaagccagtattttgcctgaaggccacagtgaaacaggccaag
ggtattctgggaaaagatgtcagcgggttcagcgacccctactgcctgctgggcatcgag
cagaaggttggtgtagcagagggcagccctgtgtcccgacgtcggcagaaggcagtggtg
aagcacaccatcccggaagaggagacccatcgcacccaagtcaagagccagacacttaat
cccgtctgggacgagacctttatcttggagtttgaggacatagccaatgcaagctttcac
ctggacatgtgggacctggacactgtggagtctgtcaggcagaagctcggggagctcacg
gacctgcacgggctccggaggatctttaaagaagctcggaaggataaaggccaggacgac
tttctggggaatgtggttctgaggttgcaggacctgcgctgccgagaggaccagtggttc
ccgctagagccctgcacagagacctacccagaccgcggccagtgccaccttcagttccag
ttcattcacaagaggagagccacggcggccagccgctctcagcccagctacactgtacac
tttcacctactgcagcagctggtgtcccatgaagtcacacagcaccaggccggcagtacc
tcctgggacgcatcactgagtccccaggctgtcaccatcctctttctccacgccactcag
aaggacctgtcggacttccaccagtccatggcgcagtggttggcctacagccgcctctac
cagagcctggagttccccagcagctgcctcctgcaccccatcaccagcatagagtaccag
tggatccagggccgactcaaagcagaacagcgggaggagctggccacctccttcacatcc
ctgttggcctatggcctctcccttatccggaagttccgctccgtctttcccctgtctgtc
tctgactccccatccaggctgcagtccctcctcagagtcttggtccagatgtgcaaaatg
aaggcctttggagaactgtgcccagacagcgctccactgtcccagctggtttctgaagct
ctgcggatgggcacagttgagtggtttcacctgatgcagcaacaccatcagcccatgggc
atcctggaggctggcaaggccttgctaaatctggtacaggacgtcatgggtgatctgtac
cagtgtcgtcgcacatggaacaagattttccacaatgtcctcaagatagacctgttctcc
atggccttcctggagctgcagtggctggtggccaagagggtacaggaccacacggtggcg
gctggcaaccttgtttctccagatattggagagagtctgtttcagctgtatgtcagcctg
aaggagctctgccagctgggccctgtcccctcagacagccgtgaagtcctggccctggat
ggcttccaccgctggtttcagccagccatcccttcctggctgcagaagacttacagtgtc
gctctggagcgggtgcagcgtgccgtacagatggacacgctggtacccctgggcgaactg
accaagcacagcacttctgccgtggatctgtctacctgctttgcccaaattagccacact
gcccggcagctggactggccagacccagaggaggccttcatgatcactgtcaagttcgtg
gaggacacgtgccggctggccctggtctactgtagccttataaaggcccgggcccgagag
ctgtctgcagttcagaaggaccagagccaggcagctgacatgctgtgtgtggtggtaaat
aacatggagcaactacggttgatcatcgacaagctacccactcagctggcatgggaggca
ttggagcagcgggtcggggccgtgttggaggaggggcagctgcagaacacgttacatgct
cagctgcagggcgccttggcggggctgggccatgagatccgtactggtgtccgtaccctg
gcagagcagttggaggtgggcattgccacacacatccagaaactcattggcgtcaaggag
tctgttctgcccgaggatgccattctgcccctgatgaaattcttggaggtgaagctttgc
tacatgaacaccaacctggtccaggagaacttcagcagccttctgactctgttgtggacc
cacacgcttactgtgctggtggaggtggcttcttcccagcgtagctcgtccctggcttct
ggcaggctgaaggtcgcccttcagaacctggaggtctgcttccacgctgagggctgtggt
ctgccaccagaggccctgcacacagacaccttccaggctctgcagaacgacctggagctg
caggcggcctccagccgggagcttatccagaagtacttctgcagccgaatccagcagcag
gccgaaaccacttctgagaggctgggcgcagtcaccgtcaaggtctcctaccgcgcctct
gagcagaggcttcgcgtggaactgctcagtgcttctagcctgctgcccctggactccaat
ggttccagtgacccctttgttcagttgacactggaacccagacatgaattccctgaagtg
gccccccgggagacccagaagcacaagaaggaacttcacccactctttgatgagaccttt
gaattcctggtgcctgctgagccttgccaaaaagcctgggcatgcctcctgctcactgtg
ctggaccacgacagactgggagcagacgacctggagggagaggccttcttaccgctctgc
agggtacctggactgacggactgtgcagagccgggcgaagcacctcaaatgcgcctgcct
ctcacataccctgcccccaacggggacccaattctgcggctgttggagagccggaagggg
gatcgcgaggcccaggcctttgtaaagctgaggaggcagagagccaagcaggcctcccaa
catgccccgtga

DBGET integrated database retrieval system