KEGG   Mus musculus (mouse): 70472Help
Entry
70472             CDS       T01002                                 

Gene name
Atad2, 2610509G12Rik
Definition
(RefSeq) ATPase family, AAA domain containing 2
  KO
K22531  ATPase family AAA domain-containing protein 2 [EC:3.6.1.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    70472 (Atad2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     70472 (Atad2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA Bromodomain AAA_lid_3 AAA_16 IstB_IS21 AAA_2 AAA_22 AAA_18 AAA_5 RNA_helicase RuvB_N AAA_7 AAA_33 TetR_C_30 Mg_chelatase AAA_11
Motif
Other DBs
NCBI-GeneID: 70472
NCBI-ProteinID: NP_081711
MGI: 1917722
Ensembl: ENSMUSG00000022360
UniProt: Q8CDM1 G3X963 Q6IQY4
Position
15; 15 D1
AA seq 1364 aa AA seqDB search
MVVLRSSLELHSRSTTSSATDSLDLSSEFLSLQDSGGRRPRLRRAGRKSTASKAAGDGFT
VKGAETYHNTRSLRSLRNQAQTSSESSFDKNVDRTEKYSNGRHFTRQFARQQADKKEECK
EDKVIPVIRSLRNRNIAPTAEHLHEQSGDVEVRRSCRIRSRYSTMNQSVLFDKLITNTAE
AVLQKMDDMKKMRRQRMKKLEDLGVFNETEESNLTMYTRGKLKAIQRADEETTDNQDGSV
ESSEEGEEQEDDDGEDEDDEDEEEGEEDNQKRYYLRQRKTTVYYQSPLESKPRHQRKPNM
FYSGPASPARPRFRLSSTGPRSPYCKRMSRRRHAIHSSDSTSSSSSEDDCFERRTKRNRN
RAINRCLPLNFRKDEIRGIYKDRMKIGASLADVDPMQLDTSVRFDSVGGLSSHIAALKEM
VVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSRGDKRVAFFMRKGADC
LSKWVGESERQLRLLFDQAYQMRPAIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDG
LDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDKNARKEILKIHTRDWNPKPVD
MFLEELAEHCVGYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLSSITISAKDFEA
ALQKIRPASQRAVTSPGQALSAIVKPLLQNTVHRILDALQKVFPHVEVGTNKSLNSDVSC
PFLESDLAYSDDDTPSVYENGLSQKENLNFLHLNRNACYQPMSFRPRLLIVGEPGFGQSS
HLAPAVIHALEKFTVYTLDIPVLFGISTTSPEEACSQMIREAKRTAPSIVYVPHIHLWWE
IVGPTLKATFTTLLQTIPSFAPVLLLATSEKPYSALPEEVQELFTHDYGEIFNVQLPDKE
ERTKFFEDLILKQASKPPVSQKKAVLQALEVLPVAPPPEPRPLTAEEVKRLEEQEEDTFR
ELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVK
DYLKDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQES
RKKRGCSSSKYAPSYYHVMPKQNSPPVGDKKPDQEQNEKLKVPCTPVACSTPAQLKRKFH
KKSKWHVGTKIKRRKISQAKDNSLNAMNSSSRSDTEDSQHTHAEHTEPGNTDESSVEESD
KQNRLESNIDLKNNSSSSNIENELEEPKETTEGTELRKDRIVCRGDASASQVTDIPEDSE
SKEMDFLRMTLARGSQVEQQELISMEQALAILSQPTPSLVLDHKQLTNILKTVVKKSQKY
NIFQLENLYAVISQCIYEHRRDYDKTALVQKMEQAVENFNCSRS
NT seq 4095 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcctccgcagcagcctggagctgcacagtcgctccaccacctcctcggccacc
gactctctggacctgtccagtgagttcctcagcctgcaggacagcggcgggaggcggccc
agattgcgccgagccgggaggaaatcgacggcgtccaaggcggcgggcgatggattcaca
gttaagggagctgaaacctaccacaacacgcgctctttaaggtctctgagaaaccaagca
caaacttcttcagagtctagttttgacaagaacgtggacagaacagagaaatactccaat
ggcagacatttcacaaggcaatttgctcgacagcaggctgataaaaaagaagagtgcaaa
gaagacaaagttattccagttattcgctcattgaggaatagaaacattgctccaactgca
gaacatttgcacgaacaaagtggagatgttgaagttcgaagaagttgcaggattagaagt
cgttacagtaccatgaaccagtctgtgctatttgacaagcttataacaaacactgctgaa
gctgtacttcaaaagatggatgacatgaaaaagatgcgcagacagcggatgaagaagctt
gaagacttgggagtattcaatgaaacagaagagagtaatctcactatgtacacaagagga
aaactaaaggctatccagcgagctgatgaagaaacaactgataaccaggacggcagtgtg
gaatcatctgaagagggggaagagcaagaggatgatgatggcgaagatgaagatgatgaa
gatgaagaagagggagaagaagataatcaaaaaagatactatcttaggcagagaaaaaca
acggtttactaccagtctccactggaaagtaaacctcgtcaccagagaaagcccaacatg
ttttatagtggcccagcttctcctgcaagaccaagattccgcttgtcttctacgggacca
agaagtccctattgtaaacgaatgagcaggcgaaggcatgccatccacagcagtgactct
acttcctcctcctcctctgaagacgactgttttgagaggagaacaaaaaggaaccgaaat
agagctattaacaggtgcctcccactaaattttcggaaagatgaaataagagggatttat
aaagatcgaatgaaaattggagcaagccttgctgatgttgacccaatgcaactagatact
tcagtgcgctttgacagtgttggcggcctgtccagtcacattgcagctctaaaagagatg
gtggtgtttcccttactttatccagaagtcttcgaaaagtttaaaattcaacccccaaga
ggttgtttgttttatggaccacctggaactggaaaaaccctggttgctagagcacttgcc
aatgagtgcagccgaggggataagagagtggcgttcttcatgaggaaaggtgctgactgc
ctgagtaaatgggtaggagaatctgagagacagcttcggttgctatttgaccaggcctat
cagatgcgcccagcaattatattctttgatgaaattgatggtttggctccagtacgatct
agcaggcaagatcagattcacagttctattgtttcaaccctgttagctcttatggatggt
ttggacagcagaggagaaattgtggtcattggagctaccaaccggctagattccatagac
cctgctttacggaggcccggtcggtttgacagagaattcctttttagtctacctgataaa
aatgctcgaaaagagattctgaagattcatacaagagattggaatccaaagccagtggac
atgtttctagaagaactagcagaacactgtgttggctactgtggtgcggatattaagtca
atctgtgctgaagctgctttgtgcgccctgcgtcgacggtacccgcagatctacaccacc
agcgagaagcttcagctggatctctcttcaattaccatctcagctaaggattttgaggca
gctctgcagaaaataagaccagcttcccagagagctgtgacatcacccggacaggcactg
tctgccattgtgaaaccacttctgcaaaatactgttcataggatcttagacgccctacag
aaagtatttccacatgtggaagttggaacaaacaaatctttaaattcagatgtttcttgc
ccttttctagaaagtgatttggcatacagtgatgatgatacaccatctgtgtatgaaaat
ggactttctcaaaaagaaaatttaaattttcttcatttaaatagaaatgcctgttaccag
cctatgtcttttcgaccaagactattgatagtgggagaaccaggatttggacagagttct
cacttggcaccagctgtcatccatgctttggaaaaatttactgtatatacattagacatt
cctgttctttttggcatcagtacaacatctcctgaagaggcatgttcccaaatgattcgt
gaagctaagagaacagcacccagcatagtctatgtcccacatatccatttgtggtgggaa
atagttggaccgacactcaaagccacatttacaacattattacagactataccttcattt
gctccagttttattacttgcaacttctgagaaaccatactcagctttgccggaagaggta
caagaattgtttacccatgattatggagaaatttttaatgtacagttaccagataaagaa
gaacgaaccaaattttttgaagacttaattttaaaacaagcttcaaagcctcctgtgtca
caaaagaaagcagttctgcaggccttggaggtgctcccagtcgcaccaccgcctgaacca
agaccactgacagcagaggaagttaaacggcttgaagaacaagaagaagatacattcaga
gaactcaggattttcttaagaaatgtcacacatagacttgctattgataagcgattccga
gtctttactaagcctgttgaccctgatgaggttcctgattatgtcactgtcataaagcaa
ccaatggacctttcatctgtaatcagtaaaattgatttacataaatatctcactgtgaaa
gactatttgaaggatattgatctaatctgtagtaatgctttagaatacaatccagataga
gatcctggagatcgtcttattaggcatagagcttgtgctttgagagacactgcttatgca
ataattaaagaggagcttgatgaagactttgagcagctctgtgaagaaattcaggaatct
cggaagaagagaggttgtagctcctccaaatacgcaccatcttattaccacgtcatgcca
aagcaaaattctcctcctgttggtgataaaaagccagatcaagagcagaatgagaagcta
aaggtaccgtgcactcctgtggcgtgcagcacacctgctcagttgaaaagaaaattccat
aaaaagtcaaagtggcatgtaggcaccaaaataaagcgaaggaaaatttcacaagctaaa
gacaacagcttgaatgctatgaacagttcaagcaggagcgacacagaagacagccagcac
acacatgcagagcacacggagcctggaaacacggacgagtcctcggtagaagaaagtgac
aagcaaaatagacttgaaagcaacatagacttgaaaaataactcaagttcctctaatatt
gagaatgaacttgaagagcctaaggaaactacggagggcacagaactgagaaaagacagg
attgtttgcaggggtgatgcctctgcctcccaggtcacagacattcccgaagacagtgaa
tcaaaagaaatggattttctgcggatgactctagctagaggttcccaggtagagcagcag
gagctcatcagtatggagcaggctctggccatcctctctcagccgacaccctcacttgtg
ctggaccacaagcagttaacaaatattttgaagacggttgttaaaaaaagtcagaaatat
aatatattccaactggagaatttgtatgcagtaatcagccagtgtatttatgagcaccgc
agggactatgacaaaacagcgcttgttcagaaaatggagcaagcagtagaaaacttcaat
tgttccagatcatag

DBGET integrated database retrieval system