KEGG   Mus musculus (mouse): 70503
Entry
70503             CDS       T01002                                 

Gene name
Ddo, 5330420D20Rik, 5730402C02Rik, AI467244
Definition
(RefSeq) D-aspartate oxidase
  KO
K00272  D-aspartate oxidase [EC:1.4.3.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00250  Alanine, aspartate and glutamate metabolism
mmu01100  Metabolic pathways
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    70503 (Ddo)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    70503 (Ddo)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.1  D-aspartate oxidase
     70503 (Ddo)
SSDB
Motif
Pfam: DAO NAD_binding_8 Pyr_redox Pyr_redox_2 Thi4
Other DBs
NCBI-GeneID: 70503
NCBI-ProteinID: NP_081718
MGI: 1925528
Ensembl: ENSMUSG00000063428
Vega: OTTMUSG00000063434
UniProt: Q922Z0
Position
10; 10 B1
AA seq 341 aa
MDTVCIAVVGAGVIGLSTAACISQLVPGCTVTVISDRFTPDTTSNVAAGMLIPHTCADTP
VPTQKRWFRETFEHLSEIAKSAEAADAGVHLVSGWQIFRSVPAEEVPFWADVVLGFRKMT
EAELKRFPQYVFGQAFTTLKCETSAYLPWLERRIKGSGGLLLTRRIEDLWELQPSFDIVV
NCSGLGSRRLVGDPMISPVRGQVLQARAPWVKHFIRDGGGLTYVYPGMSYVTLGGTRQKG
DWNRSPDAELSREIFSRCCTLEPSLHRAYDIKEKVGLRPSRPGVRLQKEILVRGQQTLPV
VHNYGHGSGGISVHWGSALEATRLVMECIHTLRTPASLSKL
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggacacagtgtgtattgcggtcgttggagctggcgtgatagggctgtctactgcagca
tgcatttcccaactggttcccggatgcaccgtcactgtcatctcagacaggttcactcct
gataccaccagtaatgtagcggctgggatgcttattcctcacacgtgtgcagataccccg
gtacccacacagaagcgatggtttagagagaccttcgagcatctttctgaaatcgccaag
tctgcagaggctgcagatgcgggtgttcacctggtatctggttggcagatattccgcagc
gtccccgctgaagaagtgcctttctgggctgatgtggtgctgggatttcgaaagatgaca
gaggctgagctgaagcggttccctcagtatgtgtttggccaggcttttacaaccctgaag
tgcgagacttctgcctacctcccgtggctggagagaaggataaaggggagtggaggtctg
ctactcaccaggagaatagaagacctgtgggagctgcagccatcttttgatatcgtggtc
aattgctcaggcctgggaagccggcgacttgtaggtgaccccatgatttccccggtaagg
ggccaggtgctccaggcacgggccccctgggtgaagcatttcatccgagatgggggcggg
ctgacttatgtttaccctggtatgtcctatgtaaccctgggaggaactagacagaaagga
gactggaatcgatccccagatgcagaacttagcagagagattttttctcgatgctgcact
ctcgagccttccctccacagagcctacgacataaaagagaaagtggggctgagacccagc
aggccaggtgtgcggctgcagaaggagatcctagtccggggacaacagacgctgcctgtg
gtccacaactacggccacgggagtgggggcatctctgtgcactggggctctgctctggaa
gccaccaggctggtgatggagtgtatccataccctcaggacccctgcttccttgtcgaag
ctgtag

DBGET integrated database retrieval system