KEGG   Mus musculus (house mouse): 70533
Entry
70533             CDS       T01002                                 
Symbol
Btf3l4, 4632412E09Rik, 5730434I03Rik, AI316863, AU022207, AW552446
Name
(RefSeq) basic transcription factor 3-like 4
  KO
K01527  nascent polypeptide-associated complex subunit beta
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: NAC
Other DBs
NCBI-GeneID: 70533
NCBI-ProteinID: NP_081729
MGI: 1915312
Ensembl: ENSMUSG00000028568
UniProt: Q9CQH7 A2A7Z4
Position
4:complement(108671492..108691499)
AA seq 158 aa
MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMI
KDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQF
PRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEAN
NT seq 477 nt   +upstreamnt  +downstreamnt
atgaatcaagaaaagttagccaaacttcaagctcaggtccggatagggggcaagggtaca
gctcgcaggaagaagaaggtggtacataggacagctactgctgatgacaaaaagcttcag
agttcactaaagaaactggctgtgaacaatatagctggtattgaagaggtgaatatgatt
aaagacgatggcacggttattcatttcaacaatcccaaagtccaagcttccctctccgct
aacacctttgcaattactggtcatgcagaagccaaaccaatcacagaaatgcttcctggg
atattaagtcagcttggtgctgacagcttaacgagccttagaaagttagctgaacagttc
ccacggcaagtattggatagtaaagcgcccaaaccagaagacatcgatgaagaggatgat
gatgttccagatcttgtagaaaattttgatgaagcatcgaaaaatgaagctaactaa

DBGET integrated database retrieval system