KEGG   Mus musculus (mouse): 70536Help
Entry
70536             CDS       T01002                                 

Gene name
Qpct, 5730422A13Rik
Definition
(RefSeq) glutaminyl-peptide cyclotransferase (glutaminyl cyclase)
  KO
K00683  glutaminyl-peptide cyclotransferase [EC:2.3.2.5]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    70536 (Qpct)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.5  glutaminyl-peptide cyclotransferase
     70536 (Qpct)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M28: aminopeptidase Y family
   70536 (Qpct)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 70536
NCBI-ProteinID: NP_081731
MGI: 1917786
Ensembl: ENSMUSG00000024084
UniProt: Q9CYK2 A0A0R4J0G6 Q3UFN2
Structure
PDB: 

Position
17; 17 E3
AA seq 362 aa AA seqDB search
MAGSEDKLVVGTLHLLLLQATVLSLTAGNLSLVSAAWTQEKNHHQPAHLNSSSLQQVAEG
TSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRS
FSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLH
SLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLD
GMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGY
GNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYL
HL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcagcgaagacaagctcgtcgtgggcactctccacctgctgctactgcaggcg
accgtcctgtctctgacagctgggaatctgagtctggtctccgctgcctggacgcaggag
aagaaccaccaccaaccagcacatttgaattcttcatctcttcagcaagttgcagaaggc
actagcatttctgaaatgtggcaaaacgacttgagaccattgctgatagaacgatatcct
ggatcgcccggaagctattctgctcggcagcacatcatgcaacgaattcagagacttcag
gctgagtgggtcgtggaagttgacaccttcctgagtaggactccctatggctatcggtcc
ttctcaaatatcatcagcactcttaacccggaagcgaaacgacacctggtcctcgcctgc
cactacgactccaaatattttcctcgatgggacagcagagtgtttgtgggagccacggat
tcagctgtgccatgtgcaatgatgttggaacttgcccgtgccttagacaagaaactccat
tccttgaaggatgtctctggttccaagccagatctctcactccggctaattttctttgat
ggtgaagaggcttttcatcactggtcccctcaagattctctgtatgggtctcggcactta
gctcagaagatggcatcaagccctcaccctcctggatcaagaggcaccaaccaactggat
ggcatggatctgttggtcttactagatttaattggagcagcaaatccaacattccctaat
tttttccccaagactaccagatggtttaatagacttcaagcaattgaaaaggaactctat
gaattgggattactcaaggatcattctttggagaggaagtattttcagaattttggctat
ggaaatattatccaggatgaccacattccatttttaagaaaaggtgtcccagttcttcac
ctgatagcttctcctttccctgaagtctggcacaccatggatgacaatgaagaaaatcta
catgcgtcaaccattgacaatctcaacaaaatcattcaagtctttgtgttggaatatctt
cacttgtaa

DBGET integrated database retrieval system