KEGG   Mus musculus (house mouse): 70552
Entry
70552             CDS       T01002                                 
Symbol
Lrrc56, 5730427C23Rik, BB110509, mFLJ00101
Name
(RefSeq) leucine rich repeat containing 56
  KO
K25425  leucine-rich repeat-containing protein 56
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    70552 (Lrrc56)
   04812 Cytoskeleton proteins [BR:mmu04812]
    70552 (Lrrc56)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  Dynein assembly factors
   70552 (Lrrc56)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     Dynein-related proteins
      70552 (Lrrc56)
SSDB
Motif
Pfam: LRR_4 LRR_8 LRR_9 SF3A3
Other DBs
NCBI-GeneID: 70552
NCBI-ProteinID: NP_001165535
MGI: 1917802
Ensembl: ENSMUSG00000038637
UniProt: Q8K375 Q8BMW2
Position
7:140774024..140789968
AA seq 552 aa
MDPAWDGSQGSRPGTASIRVRELSWQGLNNPHPQNKRLGSHGDIHRERWVEERLSPARLQ
ALAQVDDLQLVRVLEMCVDTRKNSLGNFGLYLPNLIQLKLNHSYLGSLRDLGTSLGHLQV
LWLARCGLTDLDGIGSFLELKELYVSYNNISDLSPLCLLEQLEVLDLEGNNVEDLGQMRY
LQLCPRLAMLTLEGNLVCLKPDPGPSNKAPQGYNYRAEVKKLIPQLHVLDEVPTTCTSAP
APQTLSQDWLMVKEAIKEGSVLDILLPRLDDPHGATIRKFDPTLPVPETQPWALSLLVPG
GPLPEGLLSENPATEDHASNLTHGPGQVLCGNPTKGLRKRRNQYQEWAPLEQMPPHRPDL
AIRPSTPRPDPAESCDLAMTGLRAWTEPGLRPLLQRQLEFQQERSAQVQAQDPQKDPVEQ
EDQTGPKTSLTPPRLVSELSRTSGFHLIPSPPKYPMPPESGISSLGRSADLPFRGRRLRV
LGSLGPSLGEGSVLGERLAAVTALRALEASSGPSHRAQGCPDPKPALGPAACPPGLHCLH
HLNPIPPAHSLP
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacccagcctgggatggatcccaggggtctcgaccaggcacagctagtatccgggta
cgggagctgagctggcagggcctaaacaacccccacccacaaaacaagagactgggcagc
catggggatatccatagggagcggtgggtggaggagcgcctatcccctgctcgactgcag
gccctggcccaggtagatgacctccaactggtgagggtgctggagatgtgtgtggacacc
cgtaagaacagcctggggaacttcggattgtacctccctaacctgatccaactgaagctg
aaccacagctacctgggctccctcagagacctgggcacttcgctgggccacctgcaggtg
ctgtggctggctcgctgtggcctgactgacttggatggcattggctccttcttggaactg
aaggaactttatgtctcctacaacaacatctcggacctgagcccactgtgcctgctcgag
cagctagaggtgctggacctggagggcaacaatgtggaggacctggggcagatgcggtac
ctgcagctgtgcccacgcttggccatgctcacactggaggggaatctggtgtgcctgaag
ccagatcctggcccttccaacaaggcgccccagggctacaactacagagcagaggtaaag
aagctcatcccccagctgcacgtccttgacgaggtgcccactacatgcaccagtgcgcct
gcgccccagacgctgagccaggactggctgatggtgaaggaagccatcaaggaaggcagc
gtgcttgacattctcctccctcggctggatgatccccatggagccaccattcggaaattt
gacccaaccttgcctgtgcctgagacccagccatgggccttgtccctgctggtccctggg
ggccccttgcctgaaggtctgctttctgagaacccagccacagaagaccatgccagcaac
ctcacccatggtcctggtcaagttctctgtgggaaccccaccaaaggccttcggaaacgt
agaaaccagtaccaggaatgggcacccctggaacagatgcccccacataggccagatctg
gccatcagaccctccaccccaaggcctgaccctgcagaaagctgtgacctggccatgact
gggcttcgggcttggacggagcctggcctgcgtcctcttctccaaagacagctggagttc
cagcaggaaagatctgctcaggtccaagcccaggacccacagaaggatcctgtagaacag
gaagaccagactggacccaagacttccctaaccccgccacgcctggtctcagaactttcc
aggacatcaggctttcatttgatcccttctcccccaaagtacccaatgccacctgagtca
ggcatcagctccttggggagatctgcagacctgcccttcagaggacgtaggcttagagtt
ctgggcagcttggggcctagcctgggtgaggggtctgtcctgggtgagaggttggctgca
gtgactgccttgagagccctggaggcgtcctcaggccccagccatcgagcccagggatgt
ccagacccaaagccagcactaggtccagcagcttgccctccagggctccactgccttcat
cacctgaaccctatccctccagcccattctctcccttag

DBGET integrated database retrieval system