KEGG   Mus musculus (mouse): 70560
Entry
70560             CDS       T01002                                 

Gene name
Wars2, 5730427B17Rik, 9430020O07Rik, AI413375, T, TrpRS
Definition
(RefSeq) tryptophanyl tRNA synthetase 2 (mitochondrial)
  KO
K01867  tryptophanyl-tRNA synthetase [EC:6.1.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    70560 (Wars2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    70560 (Wars2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    70560 (Wars2)
Enzymes [BR:mmu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.2  tryptophan---tRNA ligase
     70560 (Wars2)
Amino acid related enzymes [BR:mmu01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   70560 (Wars2)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    70560 (Wars2)
 Prokaryotic type
    70560 (Wars2)
Motif
Pfam: tRNA-synt_1b Occludin_ELL
Other DBs
NCBI-GeneID: 70560
NCBI-ProteinID: NP_081738
MGI: 1917810
Ensembl: ENSMUSG00000004233
Vega: OTTMUSG00000006862
UniProt: Q9CYK1
Position
3; 3 F2.2
AA seq 360 aa
MALFSVRKARECWRFIRALHKGPAATLAPQKESGERVFSGIQPTGILHLGNYLGAIESWV
NLQEEYDTVIYSIVDLHSITVPQDPTVLQQSILDMTAVLLACGINPEKSILFQQSKVSEH
TQLSWILTCMVRLPRLQHLHQWKAKAAKQKHDGTVGLLTYPVLQAADILCYKSTHVPVGE
DQVQHMELVQDLARSFNQKYGEFFPLPKSILTSMKKVKSLRDPSSKMSKSDPDKLATVRI
TDSPEEIVQKFRKAVTDFTSEVTYEPDSRAGVSNMVAIHAAVSGLSVEEVVRSSAGLDTA
RYKLLVADAVIEKFAPIRKEIEKLKMDKDHLRKVLLVGSAKAKELASPVFEEVKKLVGIL
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcgctgttctctgtgcggaaggcccgtgagtgctggcgcttcatccgggcacttcac
aaaggacccgcagcaactctggctccccagaaggagagtggagagcgagtgttttctggc
attcagcctacaggaatcctccacctgggaaattaccttggagccatcgagagctgggtg
aacttacaggaggaatatgacacagtgatatacagcatcgtggacctccactccatcact
gtcccccaagaccccaccgtcctccagcagagcatcctggacatgactgctgtgcttctt
gcctgtggcataaacccagagaaaagtatccttttccagcagtctaaggtgtctgaacac
actcagttaagttggatcctcacctgcatggtgagactgcctcgattgcagcatttacac
cagtggaaggcaaaggctgcgaagcagaagcatgatgggaccgtaggcctgctcacatac
cctgtactccaggcagcagacatcctgtgctacaagtccacacacgttcctgtcggggag
gatcaagtccagcacatggaactagttcaggatctagctcgaagtttcaaccaaaagtat
ggggagttctttccattgcccaagtccattctcacatccatgaagaaagtgaaatctctt
cgagacccttcttccaagatgtcaaaatcggaccctgacaaactcgccactgttcgaata
acagacagcccagaggagattgtacagaaattccgcaaggctgtgacagacttcacgtca
gaggtcacctacgagccggacagcagagctggtgtttccaacatggtggcgatccacgcg
gccgtgtcgggcctctcggtggaggaggtggtgcgcagtagcgcaggcttggacactgca
cgctacaagctgctagtggccgatgctgtgattgagaaatttgctccaatcaggaaggag
attgagaaattgaaaatggataaggaccacttaagaaaggttttacttgttggatctgca
aaagccaaagaattggcctctcctgtgttcgaggaggtgaagaagttggtggggattctg
tag

DBGET integrated database retrieval system