KEGG   Mus musculus (mouse): 70574
Entry
70574             CDS       T01002                                 

Gene name
Cpm, 1110060I01Rik, 5730456K23Rik, AA589379, E030045M14Rik
Definition
(RefSeq) carboxypeptidase M
  KO
K01296  carboxypeptidase M [EC:3.4.17.12]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    70574 (Cpm)
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    70574 (Cpm)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.12  carboxypeptidase M
     70574 (Cpm)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   70574 (Cpm)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Enzymes
  70574 (Cpm)
SSDB
Motif
Pfam: Peptidase_M14 CarboxypepD_reg AstE_AspA Dioxygenase_C
Other DBs
NCBI-GeneID: 70574
NCBI-ProteinID: NP_081744
MGI: 1917824
Ensembl: ENSMUSG00000020183
Vega: OTTMUSG00000031908
UniProt: Q80V42
Position
10; 10 D2
AA seq 443 aa
MDRARLWLGLLLPVVAALDFRYHHQEGMEAFLKSVAQNYSSITHLHSIGKSVRGRNLWVL
VVGQTPKEHRVGIPEFKYVANMHGDETVGRELLLHLIDYLVSSYRKDPEITHLIDSTRIH
IMPSMNPDGFEAVQKPDCYYSNGRENYNNYDLNRNFPDAFENNNVTKQPETLAIMEWLKT
ETFVLSANLHGGALVASYPFDNGVQATGTLLSRSLTPDDDVFQHLAYTYASRNPNMTKGD
QCKNKRNFPNGIINGYSWYPLQGGMQDYNYIWAQCFEITLELSCCKYPREEKLPLFWNDN
KASLIEYIKQVHLGVKGQVFDQSGAPLPNVIVEVQDRKHICPFRTNKLGEYYLLLLPGSY
VINVTVPGHDSYLTKLTIPGKSQPFSALKKDFHLPLRWQPDSISVSNPSCPMIPLYKFMP
SHSAATKPSLGVFFMTLLYVFFK
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggaccgcgcgcgcctgtggctggggcttctgctgcccgtggtggccgccctggatttc
cgatatcaccaccaggaagggatggaggcgttcctaaagagcgtggctcagaactacagt
tcgatcacgcacttgcacagcatcgggaaatctgtgagaggtagaaacctgtgggttctc
gttgtggggcagactccaaaggaacacagagtcgggattccagaattcaaatacgtggcg
aatatgcacggagatgagactgtagggcgagaactgctgctccacctgatcgactatctg
gtgagcagttacaggaaagacccggaaatcacgcatctgattgacagcacccggatccac
atcatgccttccatgaaccccgatggattcgaagccgtccagaagcccgactgttactac
agcaatggcagggaaaactacaataattatgacctgaacagaaactttcctgatgccttt
gagaataacaatgtaacaaagcaacctgagactctggcaatcatggagtggctgaaaacg
gaaacatttgtcctctctgcgaatctccatgggggtgccctggtggccagttaccccttt
gataatggcgtacaagctacggggacactgttgtcccgaagcttaaccccggacgatgac
gttttccaacacctggcctacacctacgcctcccggaatcccaacatgacaaaaggagat
cagtgtaaaaacaagaggaacttccccaacgggattatcaacggctactcctggtaccca
ctgcaagggggaatgcaagattacaactacatctgggcccagtgctttgaaattaccctg
gagctgtcgtgctgtaaatatcctcgcgaggagaagctgccgctcttttggaacgataac
aaagcctctttgatcgaatatataaaacaggtgcacctaggggtaaagggtcaagtgttc
gatcagagtggagctccattaccgaatgtaatcgtggaagtccaagacagaaagcatatc
tgcccgtttagaaccaacaagcttggagaatactatctgcttctgctgcccgggtcctac
gtgatcaatgttacagtccctggacacgactcctacctcacgaagcttactattccaggg
aaatcccagcccttcagtgctcttaaaaaggattttcacctcccgctgcgatggcagccg
gattccatctccgtatccaatccttcgtgcccgatgattccgctgtacaaattcatgcca
agccactcggctgccacaaagcctagtctgggcgtgtttttcatgactcttttgtacgta
ttttttaaataa

DBGET integrated database retrieval system