KEGG   Mus musculus (mouse): 70575
Entry
70575             CDS       T01002                                 

Gene name
Gfod2, 5730466C23Rik
Definition
(RefSeq) glucose-fructose oxidoreductase domain containing 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: GFO_IDH_MocA GFO_IDH_MocA_C F420_oxidored ANAPC2 Shikimate_DH
Other DBs
NCBI-GeneID: 70575
NCBI-ProteinID: NP_081745
MGI: 1917825
Ensembl: ENSMUSG00000013150
Vega: OTTMUSG00000032830
UniProt: Q9CYH5
Position
8; 8 D3
AA seq 385 aa
MKLLPGVGVFGTGSSARVLVPLLRAEGFTVEALWGKTEEEAKQLAEEMNITFYTSRTDDV
LLHQDVDLVCINIPPPLTRQISVKALGIGKNVVCEKAATSMDAFRMVTASRYYPQLMSLV
GNVLRFLPAFVRMKQLIAEHYVGAVMICDARIYSGSLLSPSYGWICDELMGGGGLHTMGT
YIVDLLTHLTGQKAEKVHGLLKTFVRQNATIRGIRHVTSDDFCFFQMLMGGGVCSTVTLN
FNMPGAFVHEVMVVGSAGRLVARGADLYGQKNSAAQEELLVRDSLAVGAGLPEQGPQDVP
LLYLKGMVYMVQALRQSFQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDAIKRSSRSGEW
ETVEMLAEEPDANQNLSETLQRNNL
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaagctgctcccaggagtcggtgtgttcgggactggcagctcagcccgggtcctggtc
ccgctgctgagggcagagggcttcaccgtggaggccctgtgggggaagactgaggaagag
gcaaagcagctggccgaggagatgaacatcaccttctacaccagccgcacagacgacgtc
ttgctgcatcaagacgtagacctggtctgcatcaacatcccacctccgctcacccggcag
atatccgtgaaggctctaggaattgggaagaacgtggtgtgtgagaaggcagcgacatcc
atggacgccttccggatggtgaccgcatctcgctactacccacagctgatgagcttggtg
gggaacgttctgcgcttcctgcctgccttcgtgcgcatgaaacagctcattgcagagcac
tacgtgggtgccgtgatgatctgcgacgctcgcatctactccgggagcctgctcagcccc
agctacggctggatctgtgacgagcttatggggggcgggggcctgcacaccatgggtacc
tatatcgtggacctgttgacccacttgactggccagaaagccgagaaggtgcacgggctc
ctcaagacctttgtgaggcagaatgccaccatccgtggcatccgccatgtcaccagtgat
gacttctgttttttccagatgctcatgggtgggggggtatgcagcacagtgaccctcaac
ttcaacatgccaggtgcctttgtgcatgaggtcatggtagtgggctccgcagggcgcctt
gttgcccggggagctgacctctatgggcagaagaactctgctgcacaggaggagctgctg
gtgagagactctctggctgtgggcgcagggctccctgagcaaggtccccaggatgtccca
ctgctttacttgaaaggtatggtctatatggttcaggccttgcgtcagtccttccagggg
cagggggatcgccgtacctgggaccgcacccctgtctctatggctgcctcattcgaggac
ggactgtatatgcagagcgtggtagatgctattaaaaggtccagccggtctggggagtgg
gagactgtggagatgctggcagaggagccagatgccaaccagaatctaagtgaaacactt
cagcggaacaacctgtga

DBGET integrated database retrieval system