KEGG   Mus musculus (house mouse): 70584
Entry
70584             CDS       T01002                                 
Symbol
Pak4, 5730488L07Rik, mKIAA1142
Name
(RefSeq) p21 (RAC1) activated kinase 4
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu04660  T cell receptor signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05170  Human immunodeficiency virus 1 infection
mmu05206  MicroRNAs in cancer
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    70584 (Pak4)
   04014 Ras signaling pathway
    70584 (Pak4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    70584 (Pak4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    70584 (Pak4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    70584 (Pak4)
  09158 Development and regeneration
   04360 Axon guidance
    70584 (Pak4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    70584 (Pak4)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    70584 (Pak4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    70584 (Pak4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    70584 (Pak4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     70584 (Pak4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE20 family
   70584 (Pak4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like ABC1 Pkinase_fungal APH Kdo KIND
Other DBs
NCBI-GeneID: 70584
NCBI-ProteinID: NP_081746
MGI: 1917834
Ensembl: ENSMUSG00000030602
UniProt: Q8BTW9
Position
7:complement(28258244..28297609)
AA seq 593 aa
MFGKKKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACIT
SIQPGAPKTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRESPPPPARAHQENGMLEE
RAAPARMAPDKAGSRARATGHSEAGSGSGDRRRVGPEKRPKSSRDGPGGPQEASRDKRPL
SGPDVSTPQPGSLTSGTKLAAGRPFNTYPRADTDHPPRGAQGEPHTMAPNGPSATGLAAP
QSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPARALAAPAVPPAPGPPGPRSPQREPQR
VSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQ
RRELLFNEVVIMRDYRHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIA
AVCLAVLQALAVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGT
PYWMAPELISRLPYGPEVDIWSLGVMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNL
HKASPSLKGFLDRLLVRDPAQRATAAELLKHPFLTKAGPPASIVPLMRQHRTR
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgtttggaaagaagaagaagcgggtggagatctcagccccatccaacttcgagcaccgt
gtacacacaggctttgatcagcatgagcagaagttcacagggctgccccgccagtggcag
agcctgattgaggaatcagcacgcagacccaagcccctgatcgaccctgcctgcatcacg
tccatccagcctggagcccccaagaccatcgttcggggcagcaaaggtgccaaggatggg
gctctcactctgctgcttgacgaatttgagaacatgtcggtgacgcgctccaactcccta
cgcagagagagtccaccaccacctgcccgtgcccaccaggagaatggaatgctggaggag
cgggcagccccggccagaatggcccctgacaaagctggaagcagagcccgggccacaggc
cacagtgaggcaggcagtggcagtggtgacagacggcgggtggggccagagaaaaggccc
aaatcttcgagggatggtccaggaggaccccaggaggcctcccgcgataagcgcccactc
tctgggcctgatgtcagcactcctcagcctggcagtctgaccagcgggacaaaactagca
gctggcaggccctttaacacatacccacgggctgacacggaccacccaccccgcggtgcc
cagggggagccacataccatggcccctaatgggccttcagccacaggcctggccgctcct
cagtcttcctcctcctcccggcctcccacccgagcccgtggtgctcccagcccaggagtt
ctgggtccccatgcctctgagccccagttggcccccccagcacgtgcccttgctgcccct
gctgtacctcctgcccctgggccccctgggcctcgctcaccacagcgggagccccaacga
gtgtcccatgagcagttccgggctgccctgcagctggtggtggacccaggggaccctcgt
tcctatctagacaacttcatcaagattggtgagggctctacaggtattgtgtgcattgcc
actgtacgcagctcaggcaaactggtggccgtcaagaagatggacttgcgcaagcagcaa
agacgtgaactgctcttcaatgaggtggtgatcatgcgggactaccggcacgagaacgtg
gtggagatgtacaacagctacctggtgggtgacgaactctgggtcgtcatggagttcctg
gaaggcggcgccctcacggatattgtcacccacaccaggatgaacgaggaacagatcgcc
gccgtgtgcctggctgtgcttcaggcgctggctgtgctccacgcccagggtgtcatccac
cgtgacatcaagagtgactctatcttgctgacccatgatggccgggtgaagctgtccgac
ttcgggttttgtgcccaggtgagcaaggaggtgcctcggaggaagtcgctggtgggcacc
ccgtattggatggccccggagctcatctcccgccttccctatgggccagaggtggatatc
tggtcactgggggtgatggtgatcgagatggtggatggggagcccccttacttcaacgag
ccacccctcaaagctatgaagatgatccgggacaacctcccgccccgactgaagaacctg
cacaaggcgtcaccgtctctgaaaggcttcttggatcgcctgctagtgcgggacccggcc
cagcgggccactgctgccgagctgctgaagcacccgttcctcaccaaggcggggccacca
gccagcatcgtgcccctgatgcgccagcaccgaaccagatga

DBGET integrated database retrieval system