KEGG   Mus musculus (mouse): 70599
Entry
70599             CDS       T01002                                 

Gene name
Itprid2, 5730488C15Rik, CS, CS-, CS-1, CS1, K, KRAP, SPA, SPAG13, Ss, Ssfa2, mKIAA1927
Definition
(RefSeq) ITPR interacting domain containing 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: SSFA2_C KRAP_IP3R_bind
Other DBs
NCBI-GeneID: 70599
NCBI-ProteinID: NP_542125
MGI: 1917849
Ensembl: ENSMUSG00000027007
Vega: OTTMUSG00000013318
UniProt: Q922B9
Position
2; 2 C3
AA seq 1252 aa
MNRPLSAEAEEELEWQVASRRRKAWAKCRSSWQASETEDLSTETTTQDEDEDDEEDLPGT
KLPAPAGRGNVPNEKIAIWLKDCRTPLGASLDEQSSGTPKGVLVRNGGSFEDDLSLGAEA
NHLHEPDAQVENCNNILAKERRLQFHQKGRSMNSTGSGKSSGTVSSVSELLELYEEDPEE
ILYNLGFGRDEPDIASKIPSRFFNSSSFARGIDIKVFLSAQMQRMEVENPNYALTSRFRQ
IEVLTTVANAFSSLYSQVSGTPLQRIGSMSSVTSTKEVADSPPPLTRSNTANRLMKTLSK
LNLCVDKTEKGEGGSSPATEKGRTLSISLSEDGGGGKSDPKLQKVVKKKESSSMLATVTE
EVSGSSSTVTDSVDADRLSEEADSTISHQEESEESREAHSQEKDPLRKSAVTDPDLGHDG
RVSSHCELESSSELKSAQASSSEKEPCAPLTIPSIRNIMTQQKDSFEMEEVQSTEGEAPH
VPATCQLSLAKSKRDHLLRTASQHSDSSGFAEDSTDCVSLNHLLVNESLQAMGSSADSCD
SETTVTSLGEDHVTPTAQDQPYFNESEEESLAPLQKGRAKVEIVAEKRKADNQDFPQCVT
AENAGNNESTKGPCEPGHQITETGEHPPLAATGELPREESVESDVEKGSECEFAQYTTHH
ILRSLASFEAQGSGMSSEKKTGFPSSVDRVNTALQRAQMKVCSMSGQRVGRSLIKSKDLL
KQRYLLAKAGYPLRRSQSLPTTLLSPVRVVSSVNVRLSPGKETRCSPPSFTYKYTPEEEQ
DLEKQGTEHDGQSLVKSTIFIPPPSVKKEEAPQSEGTRLEECHHGRLAPCPQFAPISQST
CSLHSVHSEWQDRPLCEHMRTLSAHSVPNISGAACSAFSPFGCPYSHRHAAHPYRACSVN
PPSAIEMQLRRVLHDIRSSLQNLSQYPMTRGPDLAAAPYSTQNSSVLPLYENTFQELQVV
RRSLNLFRTQMMDLELAMLRQQTVVYPHMTEEDRYEVDQLQGLRNSVRMELQDLEMQLEE
RLLGLDEQLRAVRVPSPFRPSALPGMCGSRSVDNLSCPSPLNVMEPVTELIREQSYLKSE
LGLGLGDMAYEIPPGESSESVFSQATSESSSVCSSPSHTNRRSRGLPGSKPRARLVARKK
IFRASVALTPTAPSRTGSVQTPPDLESSEEAGGAEEASPVVGLASHVEEEPEDLSLMPAA
EEMHRNVEQDELQQVIREIKESIVGEIRREIVSGLLAAVSSSKAPGPKQDSH
NT seq 3759 nt   +upstreamnt  +downstreamnt
atgaaccgacccctgtcggcggaggcggaggaggaactggagtggcaagtggcgagtcgc
aggaggaaggcctgggccaagtgccgcagctcctggcaggcgtcggagaccgaggatctg
tccacagagacgacgacgcaggacgaggacgaggacgacgaggaggacctcccaggcacg
aagctgccggcacccgcggggcgaggaaacgtgcccaacgagaagatcgcgatatggctc
aaagactgccgcacccctctgggagcctcactggatgagcaaagcagtggtacgccgaag
ggtgtgcttgtgagaaatggaggaagctttgaagatgacctgtcactgggagctgaagcc
aatcacctacatgaacctgatgctcaagttgaaaactgcaacaatatcttggccaaggag
agaagactacagtttcatcagaaagggagaagtatgaattccactgggtctgggaaaagc
agtggtaccgtgtcaagtgtctcagaactgctggagctttacgaggaagatcctgaagaa
attctatataatcttggatttggacgagatgaaccagatattgcttctaaaattccttcc
agattttttaattcatcatcctttgccagaggcatagacattaaagtatttctgagtgca
cagatgcaacggatggaagtagagaacccaaactatgctctgacaagccgatttcgccaa
attgaagtcctgactactgtggccaatgcattttcttctctatattcccaagtctctgga
actccactgcagaggattggaagtatgtcctcggtgacctccaccaaggaggtggcagac
tccccgccccctctaactcgaagcaacactgcaaaccgtctgatgaaaacactatcaaaa
ctgaacttatgtgttgataaaacagagaaaggagaagggggctcttcccccgccactgag
aaaggaaggactctaagcatctcactgtctgaagatggcggcggcggcaagagtgaccct
aagcttcagaaagttgtaaagaagaaggagtcgtcttcgatgctggctacggttacagaa
gaagtctcaggtagttcatcaaccgtcacagacagcgttgatgcagacagactttccgag
gaagcagacagtaccattagccaccaggaggaaagtgaagaaagcagagaggctcacagt
caggagaaggacccgctccgcaagtctgctgtgacagatcctgacttgggtcatgatggc
cgcgtgtccagccactgcgagctggagagcagcagtgagctgaaaagtgcccaggcgtct
tcgagcgagaaagagccttgtgcacccctgacaatcccatccatacggaacataatgacg
cagcagaaagactcctttgagatggaagaggtccagagcacagagggagaagcccctcac
gtgccagccacttgccagctaagtcttgccaagtcaaaaagagatcatctgttgagaact
gcaagtcagcattccgatagcagcggctttgctgaggactccacagactgtgtctccctc
aaccacctcctggtgaacgagtccctgcaagccatggggagcagtgctgacagctgtgac
agtgaaaccaccgtcacatcgcttggtgaggaccacgtgactcctacagcgcaagaccag
ccttacttcaatgagtcagaggaggagtccctggctcctctgcagaaaggaagagcaaag
gtggaaatagtggctgagaaaaggaaagccgacaaccaagatttccctcagtgtgtgacc
gcagagaatgctggaaacaatgagtccacaaagggcccgtgtgagcctggtcatcagatc
acagaaacaggggagcatccacctctggcagccactggagagctccccagggaagagagt
gtcgagagtgatgtagagaaaggcagtgaatgtgaatttgcccagtacaccacacaccat
attctcagatccttggcttcctttgaagcgcagggcagcggtatgagctctgaaaagaaa
actgggtttccctcttctgtggacagagtgaacactgccctgcagagagctcaaatgaag
gtctgcagtatgtctgggcagagagtagggcgtagcctaataaaatcaaaggatctgttg
aaacaaaggtacttgctcgcaaaagctggctatcctctgagaaggtctcagtctttgccc
accactttactgagcccagtacgggtggtgtcttctgtcaatgtgcgattatctccagga
aaagagaccaggtgcagcccaccgtccttcacctacaagtacacacccgaagaggaacaa
gacctggaaaagcaaggaactgaacacgatggtcagtctctggttaaatctaccatcttc
atcccgccaccctctgtgaagaaagaagaagcccctcagagtgaggggacacgactggag
gaatgccaccatggaaggcttgccccctgcccacagttcgctccaatatcccagtccacc
tgctcccttcactctgtccactctgagtggcaggacagacccctgtgtgaacacatgagg
actctgagtgcccacagtgtccccaacatatcgggtgccgcatgtagtgccttctctcct
ttcgggtgtccctattcacacagacatgctgcccacccatacagggcatgctctgtgaat
cctccttctgccattgagatgcagttgcggagagtgttgcatgatattagaagctcacta
cagaatctttcacagtatcctatgacgagaggacctgaccttgctgctgctccatacagt
actcagaactcgtctgtcctacctctttatgaaaataccttccaggagcttcaagtcgtg
aggcggagcctgaatctgttcagaacgcagatgatggacttggagctggccatgctgcgg
cagcaaaccgtggtgtaccctcatatgacagaggaggacaggtatgaagttgatcagctg
cagggtttgcggaactctgtccgaatggaactgcaggacctggagatgcagctggaggag
cgcttgctgggcctggatgagcagctccgtgcagtgcgggtgccatcacctttccgcccc
tctgcactcccggggatgtgtggcagcaggagcgtagataacttatcatgcccgtctcca
ctgaacgtcatggagcccgtcacagagctaattcgggagcaatcatacctgaagtctgag
ctgggcctgggccttggagacatggcgtatgaaattcctcctggagagagctcggagtcc
gttttctctcaagccacatcagagtcatcttccgtctgctccagcccctcccacaccaac
agaagatctagagggctacctgggagcaaacccagagcccgcttagtggcgagaaagaag
atattccgagcctctgtggccctgacaccaactgccccctctagaacaggctctgtgcaa
acacctccagatctggagagttccgaagaagctggaggagctgaggaagcatccccggta
gtggggcttgcatctcacgtggaggaagagccagaggatctctcactgatgccagcagcc
gaggagatgcacaggaatgtggagcaagatgaactgcagcaagtcatccgagagattaaa
gagtctattgttggggaaattcgacgagaaattgtaagtggacttttggcagcagtgtct
tcaagtaaagcacctggtcctaagcaggacagccactga

DBGET integrated database retrieval system