KEGG   Mus musculus (mouse): 70603
Entry
70603             CDS       T01002                                 

Gene name
Mutyh, 5730495A01Rik, Mutyha, Mutyhalpha, Mutyhb, Mutyhbeta, Mutyhc, Myh
Definition
(RefSeq) mutY DNA glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    70603 (Mutyh)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    70603 (Mutyh)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     70603 (Mutyh)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     70603 (Mutyh)
 Prokaryotic type
     70603 (Mutyh)
SSDB
Motif
Pfam: NUDIX_4 HhH-GPD HHH EndIII_4Fe-2S
Other DBs
NCBI-GeneID: 70603
NCBI-ProteinID: NP_001153053
MGI: 1917853
Ensembl: ENSMUSG00000028687
Vega: OTTMUSG00000009751
UniProt: Q99P21 Q762C9
Position
4; 4 D1
AA seq 515 aa
MKKLQASVRSHKKQPANHKRRRTRALSSSQAKPSSLDGLAKQKREELLQASVSPYHLFSD
VADVTAFRSNLLSWYDQEKRDLPWRNLAKEEANSDRRAYAVWVSEVMLQQTQVATVIDYY
TRWMQKWPKLQDLASASLEEVNQLWSGLGYYSRGRRLQEGARKVVEELGGHMPRTAETLQ
QLLPGVGRYTAGAIASIAFDQVTGVVDGNVLRVLCRVRAIGADPTSTLVSHHLWNLAQQL
VDPARPGDFNQAAMELGATVCTPQRPLCSHCPVQSLCRAYQRVQRGQLSALPGRPDIEEC
ALNTRQCQLCLTSSSPWDPSMGVANFPRKASRRPPREEYSATCVVEQPGAIGGPLVLLVQ
RPDSGLLAGLWEFPSVTLEPSEQHQHKALLQELQRWCGPLPAIRLQHLGEVIHIFSHIKL
TYQVYSLALDQAPASTAPPGARWLTWEEFCNAAVSTAMKKVFRMYEDHRQGTRKGSKRSQ
VCPPSSRKKPSLGQQVLDTFFQRHIPTDKPNSTTQ
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgaagaaactccaagcatctgtgaggagtcacaaaaagcaaccagccaaccacaagaga
aggagaacacgtgcccttagcagcagccaggccaagccttccagcctggatggcctggcc
aagcagaagagagaggagttactgcaggcctctgtctccccatatcatctcttcagcgac
gtggccgatgtcacagctttccgaagcaacttgctcagctggtatgaccaagagaagcgt
gacctcccttggagaaacttggcaaaagaagaggccaactcggacaggagggcctatgct
gtgtgggtgtcagaggttatgctgcagcagacccaggttgccacagtgatcgactattat
actcgatggatgcagaagtggccaaagcttcaagacctggccagcgcttccctggaggag
gtgaaccagctctggtctggcctgggctactattctcgaggccgtcggctacaagaagga
gctaggaaggtggtagaggagctaggaggccatatgccacgtacagcagagaccctacag
cagctcctgcctggtgtggggcggtacacggctggagccattgcttccatcgcctttgac
caggtaaccggtgtggtggatgggaacgttttacgggtgctgtgccgtgtccgggccatt
ggtgccgatcccaccagcacccttgtctctcatcacctctggaacttagcccagcagctc
gtggacccagcccggcctggggacttcaatcaagctgccatggagctgggggctacagtg
tgcaccccacagcgccctctctgcagccattgccccgtgcagagtttatgccgggcatac
cagagggtgcagcggggtcagctctcagccttgccaggccgtcctgacatagaggagtgt
gctctcaacactagacagtgccagctttgcctcacttcctcaagcccctgggaccccagc
atgggagtggccaactttcctcgaaaggccagccgcaggcctcccagggaggagtactct
gccacctgtgttgtggagcagcccggagccatcgggggtcccctggtcctcctggtgcaa
aggcctgactcaggtctgctggcaggactgtgggagttcccatctgtcaccttggagccc
tcagaacagcatcagcacaaagcccttctgcaggaactgcagcgctggtgtgggcccctc
cctgccattcgtctccagcaccttggggaggttatccacatcttctctcacatcaaactg
acgtatcaagtatatagtctggctctagatcaagccccagcgagcactgcacctcctggc
gctcgatggctgacctgggaggaattctgcaatgcagctgtgtctactgccatgaaaaag
gtgttccgcatgtatgaggaccatcggcaagggacccgcaagggttcaaaaaggtcccag
gtgtgtcctccatcaagcaggaaaaaacccagcctgggacagcaagtcctggatactttc
tttcagcgtcatatccccacagacaaacccaacagtactacccagtga

DBGET integrated database retrieval system