KEGG   Mus musculus (mouse): 70611Help
Entry
70611             CDS       T01002                                 

Gene name
Fbxo33, 5730501N20Rik, AI642135
Definition
(RefSeq) F-box protein 33
  KO
K10310  F-box protein 33
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    70611 (Fbxo33)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     70611 (Fbxo33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F-box-like F-box
Motif
Other DBs
NCBI-GeneID: 70611
NCBI-ProteinID: NP_001028328
MGI: 1917861
Ensembl: ENSMUSG00000035329
Vega: OTTMUSG00000034929
UniProt: Q8VE08
Position
12; 12 C1
AA seq 562 aa AA seqDB search
MLLFLSVPQPRPPGARTRAGAARLVRWRRRQRLRLLQLRRLRGLLRGLRRRPGTGGRRPS
RMALCGQAAGAASLPSELIVHIFSFLPAPDRLRASASCSHWRECLFYPALWPQLRICLRV
SPAEQPRLEFLMRKCGWFVRELRVEFAAENYLSGGGGPGDGGSGGGTDTGTGGEDGEALQ
LSSRWLEVLRIYLELVLCVLLSIRNNRNLQKFSLFGDISVVHQQGSLSSTYLSRVDPDGK
KIKQIQQLFEEILSNSRQLKWLSCGFMLEIVTPTSLSSLSNPIANTMEHLSLLDNNIPGN
STLITAVELERFVNLRSLALDFCDFTAEMARVLTDSNHVPLQRLSLLVHNASVMLKSLDN
MPNDEHWKALSRKSSSLRVYLMVFDIKSEDMLKILKPSIPLERVHFDSYVTCVSGAIVDL
ISRQYDKFLTHFILMNDMIDTSGFPDLSDNRNEDPLVLLAWRCTKLTLLAIHGYTVWAHN
LIAIARLRGSDLKVLQVTEESIDFDQGELADQDVDPVQNLIEQVSLGLGQSWHAVLDIES
LSVFTEPNRHFYREMQSFSEDI
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgttgttgttcttgtcagtgccgcaaccccgaccgccgggagcgcgaacccgagccggg
gccgcccggttggtgcggtggcggcggcggcagcggctgcggctgctgcagctgcgccgg
ctgcgggggctgctgcgaggactgcgcaggcggccggggacgggcggccggcggccgagc
cggatggctctgtgcgggcaggcggccggcgccgcgtcgctgcccagcgagctcatcgtg
cacatcttctcctttctgccggcgcccgaccggctgcgggcctcggcctcctgctcgcac
tggcgggagtgcctcttctacccagcgctgtggccccagctccgcatctgcctccgcgtc
tcgcccgcggagcagccgcggctagagttcctcatgcgcaagtgcggctggttcgtgcgg
gagctgcgggttgagttcgccgcggagaattatctgagcggaggcggcggcccgggcgac
ggcggtagcggcggcggcaccgacacgggcaccggaggggaagacggggaggccctgcag
ctctcctcccgctggctggaagtactgcgcatctacttggagctggtgttgtgcgtgctg
ctcagcatccggaacaacaggaatctccagaagtttagtctttttggagacataagtgtt
gtacaccagcaaggaagtttgtccagcacgtacctcagcagggtagaccctgacggcaag
aagattaagcaaattcaacaactgtttgaagaaatactgagcaatagtaggcaactaaaa
tggctgtcctgtgggtttatgctggaaatagtaaccccaacatcactgtcgtctctgtct
aacccaattgccaacaccatggaacacctgagtttactggacaacaacattcctggcaat
agcactctgatcactgcagtggaactagagcggtttgtaaatctacgctcacttgccctg
gatttctgtgactttacagctgaaatggcgagagtcttgaccgatagcaaccatgtgcct
ttgcagcgactgtctcttctggtccacaatgcttcagtgatgctcaagtcattagacaac
atgccaaatgatgagcactggaaagccctgtcacgaaagagctccagccttcgggtctat
ctaatggtttttgatattaaaagtgaagacatgctaaagattctgaaacccagtatacca
cttgagagggttcactttgacagctacgtcacttgtgtctcaggggctattgttgatctt
atatccaggcagtatgacaagttccttacccattttatattgatgaatgatatgattgac
acatctggttttccagatcttagtgacaaccgaaacgaagatccattggttttgttagca
tggaggtgcacaaagctcacccttttggcaattcatggttacaccgtgtgggcgcacaac
ctcattgccattgctcgtcttcggggctctgacctaaaagtgcttcaagtcaccgaagaa
agcattgattttgaccaaggtgaactagccgaccaggatgtggatccagtacagaacctt
attgagcaggtatcactgggccttggtcagtcttggcacgcagtcttggacattgaatca
ctcagtgtcttcactgaaccaaatcgtcatttttacagagagatgcaaagcttcagcgaa
gacatttag

DBGET integrated database retrieval system