KEGG   Mus musculus (house mouse): 70676
Entry
70676             CDS       T01002                                 
Symbol
Gulp1, 3110030A04Rik, 5730529O06Rik, CED-6, Ced6, GULP, Gulp-2
Name
(RefSeq) GULP, engulfment adaptor PTB domain containing 1
  KO
K23285  PTB domain-containing engulfment adapter protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    70676 (Gulp1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Others
    70676 (Gulp1)
SSDB
Motif
Pfam: PID PTB PID_2 Ax_dynein_light bZIP_2 Cnn_1N DivIC Shugoshin_N DUF2004 Spc24 APG6_N TSC22 ATG16 DUF4337
Other DBs
NCBI-GeneID: 70676
NCBI-ProteinID: NP_082726
MGI: 1920407
Ensembl: ENSMUSG00000056870
UniProt: Q8K2A1
Position
1:44590540..44835998
AA seq 304 aa
MNRAFSRKKDKTWMHTPEALSKHYIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIK
KSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSES
NKHLCFVFDSEKCAEEITLTIGQAFDLAYRKFLESGGKDVETRKQIAGMQKRIQDLETEN
MELKNKVQDLESRLRTTQVSTSPAHGVTVMSPSTDIFDMIPFSPISHQSPTSARNGTQLP
PIPSRSAETKRDLFGAEPFDPFNCGSGDFPPDIQSKLDEMQEGFKMGLTLEGTVFCLDPL
DSRC
NT seq 915 nt   +upstreamnt  +downstreamnt
atgaaccgtgctttcagcagaaagaaagacaaaacatggatgcatacgcctgaagcttta
tcaaaacattacattccctataatgcaaagtttcttggcagtaccgaagtggagcagcca
aagggaacagaagttgtgagagatgctgtcaggaagctgaagtttgcaagacacatcaaa
aaatctgaaggccagaagattcctaaagttgaattgcaaatatcaatttatggagtaaaa
attctcgaacccaaaacaaaggaggttcaacacaactgccagcttcatagaatatcattt
tgcgcagatgataaaactgacaagaggatattcactttcatatgcaaagattctgagtca
aataaacatttgtgttttgtatttgacagcgaaaagtgtgctgaagaaattacattaaca
attggccaagcttttgacttggcatacagaaaatttctagaatctggaggaaaagatgta
gagacaagaaaacagattgctggaatgcagaaaagaatccaagacttagaaacagaaaac
atggaacttaaaaataaagtacaagatttagaaagccggttgagaacaactcaagtatcc
acgtctccagcccatggtgtgacagtgatgtctccttccactgatatctttgacatgatt
ccattttccccaatatcacatcagtctccaacatctgctcgcaatggcacacagctacca
cccatccctagcagatctgctgagaccaaacgggacctttttggagctgaaccttttgac
ccatttaactgtggatcaggggactttcctcctgatattcagtccaaattggatgagatg
caggaggggttcaaaatgggactaactcttgaaggaacagtgttttgtctcgacccatta
gacagcaggtgctga

DBGET integrated database retrieval system