KEGG   Mus musculus (house mouse): 70683
Entry
70683             CDS       T01002                                 
Symbol
Utp20, 3830408P06Rik, AA617408, Drim, mDRIM, mDRIN
Name
(RefSeq) UTP20 small subunit processome component
  KO
K14772  U3 small nucleolar RNA-associated protein 20
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    70683 (Utp20)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    70683 (Utp20)
SSDB
Motif
Pfam: DRIM DUF6700 UME
Other DBs
NCBI-GeneID: 70683
NCBI-ProteinID: NP_780367
MGI: 1917933
Ensembl: ENSMUSG00000004356
UniProt: E9QK83
Position
10:complement(88582469..88662676)
AA seq 2789 aa
MKPKPLSHKTENTYRFLTFAERLGNVNIDIIHRIDRTASYDEDVETYFFEALLKWRELNL
TEHFGKFYKEVIDKCQSFNQLVYHQNEIVQSLKTHLQIRNSLAYQPLLDLVVQLARDLQT
DFYPHFEDFFLTITSILETQDTELLEWAFTSLSYLYKYLWRLMVKDMSKIYSLYSTLLAH
KKLHIRNFAAESFTFLMRKVSDKNALFNLMFLDLNEHPEKVEGVGQLLFEMCKGVRNMFH
SCTGQALKLLLQKLGPVTETETQLPWILVGETLKTMAKSSVVYIYKEHFGVFFDCLQESL
LELHNKVTEANCCENSEQMRRLLETYLIVVKHGSGSKITRPADVCGVLSEALQTASLSTS
CRKTLLDVVSALLLAENVSLPETLIKETVEKVFESKFERRSVLDFSEVMFAMKQFEQLFL
PSFLLYIENCFLMDNSVVSDEALAILAKLILHKAPPPTAGSMAIEKYPLVFSQQTVGSYL
KQRKADSKRRKEQFPVLSHLLSIVQLPPNKDATYLSRSWAALVVLPHLRPLEKEKTISLV
SCFIESLFLAVDRGSFGKGHLFVLCQAVNTLLSLEESSELLHLVPVGRVKHLVLTFPTEP
SVLLLADLYYQRLALCGCKGPLSEEALMELFPKLQANISTGVSKIRLLTIRILNHFDIRL
PVSMEDDGLSERQSAFAILRQAELVPATVSDYREKLLHLRKLRHDVVQGAVPQGRLQEVP
LRYLLGMLYVNFSALWDPVIELISSHAYGMENKQFWNVCYEHLEKAASHAEKELHKDVRD
EESTGDESWEQTQEGDVGDLYQQQLALKTDCRERLDHTNFRFLLWRALAKFPERVEPRSR
ELSPLFLRFINNEYYPADLQVAPTQDLRKKGRGAVAEEEEEEEPAAGEDEELEEEAVPTE
DAPQKKKTRRAAAKQLIAHLQVFSKFSNPRALYLESKLYELYLQLLLHQDQAVQKITLDC
IMTYRHPHILPYRENLQRLLDDRSFKEEIVHFNISEDNTVVKAAHRADLFPILMRILYGR
MKNKTGSKTQGKSASGTRMAIVLRFLAGTQPEEIQLFLDLLSEPVKHFKDGDCCSAVIQA
VEDLDVSKVLPVGRQHGVLNSLEVVLKNISHLISTYLPKILQILLCMTATVSHILDQREK
IQLRFINPLKNLRRLGIKMVTDIFLDWESYQFKAEEIDAVFHGTVWPQICRLGSESQYSP
TPLLKLISIWSRNARYFPLLAKQKPGHPEYDILTNVFAVLSAKNLSEATASIIMDIVDDL
LNLPDFQPTEAVPSLPVTGCVYADVAEDTEPVTVGGRLVLPHVPAILQYLSKTTISAEKV
KKKKNRAQVSKELGILSKISKFMKDREQCSLLITLLLPFLLRGNVAQDTELDILVTVQNL
LQHCLHPAHFLRPLAKLFSVIKNKLSRQLLCTVFQSLSDFESRLKYITDIVKLNAFDKRH
LDDINFDVRFSAFQTITSNIKAMQTVDADYLIAVMHNCFYNMEIGDMSLSDNASICLTSI
IKRLAALNVTEKEYKEIIHRTLLEKLRKGLKSQTESVQHDYTLILSCLIQTFPNQLEFKD
LVQLTHCHDPEMDFFENMKHIQIHRRARALKKLAKQLLEGQVVLSSKSLQNYIMPYAMAP
ILDEKMLKHENITIAATEVIGAICRHLSWPAYVYYLKHFIHVLQSGQINQKLAVSLLVIV
LEAFHFDYKTLEEQMGNVKNEENTVEMAELLEPEAMEVEDMDEAGKEQASERLSDSKEAL
GAPEAAASEGTVAKEQECISKSVSFLPRNKEELERTIQTIQGAITGDILPRLHKCLASAT
KREEEHKLVKSKVVNDEEVVRVPLAFAMVKLMRSLPREVMEANLPSILLKVCVLLKNRAQ
EIRDIARSTLSKIIEDLGVHFLQYVLKELQTTLVRGYQVHVLTFTVYTLLQGLSSKLQVG
DLDSCLHIMTEIFNHELFGALAEEKEVKQILSKVMEARRSKSYDSYEILGKFVGKQQVTK
LILPLKEILQNTTSLKLARKVHETLRRIIAGLIVNPDMTADALLLLSYGLVSENLPLLTE
KEKKPAAPVPDARLPPQSCLLLPATPVRGGPKAVVNKKTNMHIFIESGLRLLHLSLKTSR
IKSSSEHVLEMLDPFVSVLINCLGAQDVKVITGALQCLIWVLRFPLPSIASKAEQLTKHL
FLLLKNYARVGAARGQNFHLVVNCFKCVTIVVKKVKSHQITEKQLQVLLAYAEEDIYDTS
RQATAFGLLKAILSRKLLVPEIDDIMRKVSKLAISAQNEPARVQCRQVFLKYILDYPLGE
KLRPNLEFMLAQLNYEHETGRESTLEMIAYLFETFPQGLLHEHCGMFFIPLCLMMVNDDS
AMCKRMASMAIKSLLSKVDREKKDWLFGLVTSWFEAKKRLNRQLAALACGLFVESEGVDF
ERRLGTLLPVIEKEIDPENFKDIIEETEEKAADRLLFGFLTLMRKLIKECSIIHFTKPSE
TLSKIWSHVHSHLRHPHSWVWLTAAQIFGLLFASCQPEELIQKWKGKKTKKKTSDPIAVR
FLTSDLGQKMKSISLASCHQLHSKFLDESLGEQVVKNLLFIAKVLYLLELESGNKRGEVK
DSEEQDTLADALAREAAEEKAGAGGKMESNREKKEEPSKPATLMWLIQKLSRMAKLEAAY
SPRNPLKRTCIFKFLGAVAVDLGVDRVKPYLPLIIAPLFRELNSTFAEQDPVLKNLSQEI
IELLKKLVGLESFSLAFASVQKQASEKRALRKKRKALEFVTNPDIAAKKKLKKHKNKSEA
KKRKIEFLRPGYKAKRQKSHSLRDLAMVE
NT seq 8370 nt   +upstreamnt  +downstreamnt
atgaagccaaagccactttcgcacaagaccgagaacacataccggtttcttacatttgca
gagagactggggaatgtgaacattgatattattcaccgtatcgacagaactgcaagctat
gacgaggacgtcgagacttacttcttcgaggctctgctgaagtggagagagctgaacctt
acggaacatttcgggaaattttacaaagaagtcattgacaaatgtcagtcttttaaccag
ttggtctatcatcaaaatgaaattgtccagagcttgaagactcacctgcaaattaggaac
agtttggcctaccaacctcttttggatttagtagtacagttggcacgggatctgcagact
gatttctacccccactttgaagacttcttcctgacaatcacgtccatcctggagactcag
gacacagaactgttagaatgggctttcacctcgctctcgtatctttacaagtacctgtgg
aggctgatggtgaaggacatgtccaagatatacagcttgtatagcaccctcttggctcat
aaaaaactacatataagaaattttgcagccgaaagttttactttcttaatgagaaaggtc
tctgataaaaatgcacttttcaacttaatgtttcttgatcttaatgaacatccagagaaa
gtggaaggagttggacagctgctctttgaaatgtgcaagggagtcagaaatatgtttcac
tcctgcacaggccaggcactgaagctccttttgcaaaagctaggaccagtcactgaaaca
gaaactcaactaccgtggattttagttggggaaaccctaaaaaccatggccaaatcctct
gtagtgtatatctataaggaacattttggtgtgttttttgactgtttgcaagagtcactc
ctggagctacacaacaaagtgacagaagcaaactgctgtgagaactctgaacagatgagg
cgcttgctagaaacatacctgatcgtcgtgaaacacggaagcgggtccaagataacacgg
cctgctgatgtttgtggggtattgtctgaagcattgcagacagccagtctctccacatct
tgccgaaagactctcttggatgtagtttctgctttgctcctagctgagaatgtttccttg
ccagagaccctcatcaaagaaaccgtagaaaaggtattcgaaagcaaatttgagagacgt
tcggttttggatttttctgaagtcatgtttgctatgaagcagtttgagcagctgttcctg
ccgagctttctcttgtacattgagaattgcttcttaatggacaactctgtggtcagtgat
gaagcactggccattttagccaagctcattctgcacaaagctcctcctcccactgccggc
tccatggccattgaaaaataccctctggttttctcacagcagacagtgggatcctactta
aagcagaggaaggctgactccaagagaagaaaggaacagttcccagtcttaagccatctc
ttatccatagttcagttacccccaaataaagatgccacatacctttcacggtcttgggca
gcccttgtggtattacctcatcttagacctcttgagaaagagaagacaatatcgcttgtg
tcctgcttcatagagtcactcttcctggctgttgacagagggagctttgggaaaggacat
ttatttgttctttgtcaagctgtaaatactctactaagtttggaagagtcttcagaactt
cttcatctggttcctgtgggacgagtgaagcacttagtgttgacctttccaacggagcca
tctgtgttgctgttggccgatctctattatcagaggctagcattatgtggatgcaaaggg
ccactctctgaggaggctttaatggaattatttcccaagttacaagcaaatatctcaact
ggtgtctccaagattcgacttttgacaataaggatactaaatcattttgacatccggctt
ccagtttcaatggaggatgatgggctctcggagcgacagtcagcctttgctatattacgc
caggctgaactcgtgccagcaactgtgagcgattacagagaaaagcttctgcacttgagg
aagctgagacatgatgtggtgcagggtgcagtccctcagggacggctgcaggaggtgcca
ctccgttatctgttaggtatgctgtatgtcaacttcagtgccctctgggaccctgttatt
gagctcataagttctcatgcctatggaatggaaaacaagcaattctggaatgtctgctat
gaacatctagaaaaggcagcttcccatgccgagaaagaacttcacaaggatgtgagggat
gaagagtctacaggagatgaaagttgggagcaaacccaggaaggagacgttggggatctt
taccagcagcagttagcattgaaaaccgactgtcgggagcgactggaccacaccaacttc
cgattcttgctttggagagctttggccaaattcccagagcgagtagagccacggtccagg
gaactctcccctcttttcctgagattcatcaacaatgagtattatccagcagatctgcaa
gttgctcctactcaggatctacgcaaaaaaggtcgaggagcagtggctgaggaggaggag
gaggaagaacctgctgctggggaggatgaggaactggaggaagaggccgtgcccacagag
gacgcgccccagaagaaaaagacgagaagggctgcagcaaagcagctaattgctcattta
caagtcttctctaagttctcaaacccacgggccttatatctagaatccaagttgtacgag
ttgtatcttcagttattgctgcaccaagatcaagctgtgcaaaagataaccttggactgc
ataatgacgtatagacatcctcatatcctcccttacagggaaaacttacaaaggctgctg
gacgacaggagctttaaggaagagatcgtgcatttcaacatctcagaagataacacggta
gtgaaagcggcccaccgggcagacttgtttccgattctgatgagaattttgtatggacgg
atgaagaataagacagggagtaaaacccagggcaaatctgcttcaggaacccgcatggcg
attgttttacggttcctcgcagggacccaacctgaagagatccagttattcttagacctg
ctgtctgaaccagtgaagcacttcaaggacggagactgctgttctgctgtcatccaggca
gtagaggatttagatgtgtctaaagttcttcctgtggggcggcagcacggcgtcttgaac
agcctggaggtcgtgttaaagaacatcagtcatctcatcagcacataccttcccaagatc
ctgcagatcctactgtgtatgacagcaactgtctcccacatcctcgaccagcgagagaag
attcagttgagatttattaacccactgaaaaatttaagacgtttgggaatcaagatggtc
actgatatctttttggattgggaatcctatcagttcaaagcagaagaaattgatgctgtg
tttcatggtacagtttggccccagatctgcaggcttggatctgagagtcagtattcgcct
actcctctgttgaaactaattagcatctggagcagaaatgcaagatatttccctcttctg
gctaaacagaaacctgggcatccagaatatgatatcctgaccaatgtctttgcagttctc
tcagcaaagaacctgtcggaggccacagctagcattataatggatatagttgatgatctc
ctcaaccttccagatttccagcccacagaagcagtgccaagcttgccagtaactggctgt
gtgtacgccgacgtagcagaagacacagagcctgtgactgtaggagggagactggttctg
ccgcatgtgcctgcaattcttcagtacctcagcaaaaccacgataagtgcagaaaaggtg
aagaagaagaagaacagggctcaagtcagtaaggagctcggcattctttccaagataagc
aagtttatgaaagacagagaacagtgttctctcctcattacactgctccttccgttcctc
ctccgcggcaatgttgctcaggatacagagcttgacatcctggtgacagtgcagaacttg
ttacagcactgtctgcatcccgcacacttcctcagacctctcgccaaactcttttcagtt
attaagaacaagttgtcaagacagctgctctgtaccgttttccagagtctgtctgatttt
gaaagtagactaaaatacattacagatatcgtaaagcttaatgcctttgataaaagacat
ctcgatgacatcaactttgacgttagattctcagccttccagaccatcacctccaacata
aaggcaatgcagacagtggatgcggactacctcatcgctgtgatgcacaactgtttctat
aatatggagataggagacatgtctttaagtgacaatgccagcatatgcttgacaagtatc
atcaaaaggctagctgctctgaatgtcacagagaaagagtataaggagatcattcaccgg
acactcctggagaaactgaggaaggggcttaagagccagacagagagtgttcaacatgac
tataccctgatcctttcctgtttgattcaaacttttccaaatcaactggaatttaaggac
ttggtgcagctcactcattgccatgacccggaaatggacttctttgagaacatgaagcac
attcagatccacagacgagcaagagccctgaagaaactggctaagcagctcctggaaggc
caggttgtgctgtcttctaaatctcttcagaattacatcatgccttatgccatggctcca
attcttgatgagaaaatgctcaagcatgaaaacataactattgcagccacggaggttatc
ggcgccatctgcagacacctgtcttggccagcatatgtctattacttgaaacatttcatc
catgtcttgcagtcaggccaaatcaaccagaaactggctgtcagtttgctggtgatcgtg
ttggaagccttccattttgactacaaaactcttgaagaacaaatgggaaatgttaagaat
gaagaaaacacggttgagatggctgagttactggagcctgaagccatggaagtggaggac
atggatgaggcagggaaggaacaagcctctgagagattgtcagacagcaaggaggctctg
ggagcccccgaggcagctgcttctgaggggacggtggctaaggagcaagagtgcatctcc
aagtctgtctcttttcttcctcggaataaggaggagctggaaagaacaattcaaaccatc
cagggagccataactggcgacatcctccccaggctgcataagtgcctcgcgtctgcgacc
aaaagagaagaagagcacaaactggtcaagtcaaaggtcgtgaacgatgaggaagtagtc
cgagtgcccctggcttttgccatggttaagctgatgaggtccctgccacgggaagttatg
gaggcaaatctgcccagtattttgctgaaagtgtgtgtcctcctcaagaacagagcacag
gaaatcagagacattgcacgcagcaccctctccaaaataatagaagatctgggcgtgcac
tttctacagtacgtcctgaaagaattacagacgacccttgtccgtgggtatcaggttcac
gtgctcactttcactgtttacacgttgctgcaaggcctctccagcaagctgcaagttggg
gatttagattcttgtcttcacataatgactgagatttttaaccatgaattatttggtgcc
cttgctgaagaaaaggaagtaaagcagattctgtccaaagtcatggaggctcgaaggagc
aagagttacgattcttatgaaatcctgggcaagtttgtgggaaaacagcaagttacgaaa
cttattcttccattaaaagagatcctacagaataccacgagtttaaaacttgcccggaaa
gttcacgaaaccttacgccgaattatagcagggttaattgtgaatccagacatgacagca
gatgctcttctgctgctcagttacgggctggtcagtgaaaatctgccgctgctaacagaa
aaggaaaaaaagccagcagcccctgtacctgatgctcgactgccaccccagagctgcctt
ctgctccccgcaactccagttcgaggtgggccaaaagcggtcgtgaacaagaaaaccaac
atgcacatattcattgagtctgggcttcggctgctgcacctgagtctaaagacgtccagg
atcaagtcttctagtgagcatgtgctggaaatgttggacccttttgtgtccgtcctcata
aactgcctgggggcccaggatgtgaaggtgatcacgggtgctttgcagtgcctgatctgg
gtcttgcggttccctctgccttccatagcaagcaaagcagagcagctgacgaaacacctt
ttcctcttgctgaagaactatgcaagagtgggggctgcccggggccagaacttccacctg
gtcgtgaactgtttcaagtgtgtgaccatcgttgtaaagaaagtcaagtctcaccagata
actgagaaacaacttcaggttcttttggcttatgctgaggaagatatttatgatacttca
agacaagccactgcgtttggtcttctaaaggctattttatcaagaaaattattggtccca
gaaattgatgatatcatgcggaaagtatccaagttggcgatttctgcacaaaatgaaccg
gccagggtccagtgcagacaggttttcctgaaatacattcttgactatccccttggtgag
aaattgagaccgaacttggaattcatgcttgctcagctgaattatgagcacgagacggga
agagaatctactttggaaatgattgcctatctgtttgagaccttccctcagggactcctc
catgagcactgcgggatgttcttcatccctctttgcctgatgatggtcaacgatgactct
gccatgtgcaagaggatggcatccatggccatcaagtccttactcagcaaggtcgaccgt
gagaagaaagactggctctttgggctagtcacctcctggttcgaagcaaaaaagagatta
aacaggcaactagctgccctggcctgtggtttattcgtggaaagtgaaggagttgatttt
gagagaaggcttggaactcttcttcctgtgattgaaaaggaaattgatcctgaaaatttt
aaagatatcatagaggagacagaagaaaaggctgcagatcgcctgctgttcggttttctc
acactgatgaggaaactcatcaaagagtgtagcattattcactttaccaagccctctgag
acgctgagtaaaatctggagtcacgtgcactctcacctcagacacccgcacagctgggtg
tggctcacagcagcccagattttcggattgctctttgcctcttgccaaccagaggagctc
attcaaaagtggaaaggcaaaaagaccaaaaagaagacctcagaccctatagcagtcagg
ttcctaacaagtgaccttggccagaagatgaagagtatctccctggcttcatgccaccag
ctgcattccaaattcttagatgagtctctgggagagcaggttgttaagaatttactgttc
atagcaaaagtcttatatttgctggaacttgaatctgggaataagcgaggagaggtaaaa
gactcagaagaacaagacactttagcagatgctctggccagagaggcggcagaagagaag
gctggtgcaggtgggaagatggagtccaacagagaaaagaaggaagagcccagcaagccg
gccacattgatgtggctaatccagaagctgtcccgaatggctaagctggaagcagcctat
tcgcccagaaaccccttaaagagaacatgcatctttaagttcctcggcgccgtagctgtg
gatcttggagtagaccgggtaaagccgtatctcccactgatcatcgctcccctgtttcga
gaactcaacagcacctttgcggagcaagatcctgtgctgaagaatttatcccaggaaatc
atagaattactcaagaagctggtcgggctggagagcttctcactagcctttgcctccgtc
cagaaacaggctagtgagaagagggctctccgcaaaaagaggaaggccctggagtttgta
actaatcccgatattgctgccaagaagaagttgaagaaacataaaaataagagtgaagca
aagaagaggaagatagagttcctgcgccccggctataaagccaagagacaaaagtcccac
agcctcagagacttagcaatggtggagtga

DBGET integrated database retrieval system