KEGG   Mus musculus (mouse): 70701
Entry
70701             CDS       T01002                                 

Symbol
Nipal1, 3830408G10Rik, Npal1
Name
(RefSeq) NIPA-like domain containing 1
  KO
K22733  magnesium transporter
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    70701 (Nipal1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC57: NiPA-like magnesium transporter
   70701 (Nipal1)
SSDB
Motif
Pfam: Mg_trans_NIPA EamA HisKA_4TM
Other DBs
NCBI-GeneID: 70701
NCBI-ProteinID: NP_001074674
MGI: 1917951
Ensembl: ENSMUSG00000067219
Vega: OTTMUSG00000054646
UniProt: Q8BMW7
Position
5; 5 C3.2
AA seq 416 aa
MGVQLRLPPGEPCHEGYVLSLVCSNSSRASCEITNVSESLPYPVVYTNLNSSKTNFSISA
SVENKYNLYVGLVLAISSSVFIGSSFILKKKGLLQLADKGITRAGQGGHSYLKEWLWWAG
LLSMGAGEAANFAAYAFAPATLVTPLGALSVLISAILSSYFLNERLNIHGKIGCILSVLG
STVMVIHAPQEGEVTSLHEMEMKLRDPGFVSFAVIISVISLVLILIVAPKKGQTNILVYI
AICSLIGAFSVSSVKGLGIAIKELLERKPVYKDPLFFILLTMLALSVTTQINYLNKALDT
FNTSLVTPIYYVFFTSMVVTCSAILFQEWYGMKAGDIIGTLSGFFTIINGIFLLHAFKNT
NITWSELMSTAKKEALSPNGNQNSYVLLENADFSASGYDDDITLFSRTNDQSSHKL
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgggggtacagctgaggctgccacccggagagccctgccatgaagggtatgtactgtcg
ctggtctgctccaactcttcccgggcttcgtgcgagatcacaaatgtgtcagagtcgctg
ccttatcctgtcgtctacacgaacctgaattcctctaaaaccaacttcagcatttcagca
agtgtagaaaacaaatacaatctgtatgtgggcttggtattggccataagctccagcgtt
ttcattggctctagtttcatactcaaaaagaagggtctcttgcaactggccgacaagggc
atcaccagagcagggcaaggtggacattcttacctcaaggaatggttgtggtgggcagga
ctgctgtcaatgggagccggagaggctgcgaacttcgccgcttatgcctttgcgcctgcc
accttggtcaccccactgggggctctgagcgttctcataagtgcaatattgtcttcctat
tttttaaatgagcgcttgaatattcacgggaaaataggctgcattttaagcgtattgggg
tcaactgtgatggttatccacgccccacaagagggagaagtcacatctttgcatgaaatg
gaaatgaaattgagagatccagggttcgtttcctttgctgtgatcatctctgtgatctca
ctggtgctgattttgattgtggcccccaagaaaggacagactaatatattagtctatatc
gcaatctgctctttgattggagcgttttccgtctcttctgtcaaaggcttgggaattgcc
attaaggaactgctggaacggaagcctgtttacaaggatcccctgttcttcatcctgttg
accatgcttgcactttccgtgaccacccagattaactatctcaacaaggccctggacact
ttcaacacatccctggtgactcccatttattacgtgttcttcacatccatggtggtaact
tgttctgccatcctgttccaggagtggtatggcatgaaagctggagatatcatcggtacc
ctgagcgggttcttcaccatcatcaatggcatcttcctcctacatgcttttaaaaacacc
aacatcacctggagtgaactcatgtctactgctaagaaagaagccctttctccaaatggc
aatcagaacagttatgttttactagagaacgcagacttctcagcctctgggtatgatgac
gacatcaccctgtttagcaggaccaatgaccaaagtagccataaactttga

DBGET integrated database retrieval system