KEGG   Mus musculus (mouse): 70757
Entry
70757             CDS       T01002                                 

Gene name
Hacd2, 6330408J20Rik, AI255777, AI481689, Hcad2, Ptplb
Definition
(RefSeq) 3-hydroxyacyl-CoA dehydratase 2
  KO
K10703  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00062  Fatty acid elongation
mmu01040  Biosynthesis of unsaturated fatty acids
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
Module
mmu_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    70757 (Hacd2)
   01040 Biosynthesis of unsaturated fatty acids
    70757 (Hacd2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    70757 (Hacd2)
Enzymes [BR:mmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     70757 (Hacd2)
Lipid biosynthesis proteins [BR:mmu01004]
 Fatty acid synthase
  Component type
   70757 (Hacd2)
SSDB
Motif
Pfam: PTPLA
Other DBs
NCBI-GeneID: 70757
NCBI-ProteinID: NP_076076
MGI: 1918007
Ensembl: ENSMUSG00000035376
UniProt: Q9D3B1
Position
16; 16 B3
AA seq 254 aa
MAAAAATAATKGNGGGSGRVGAGDSSGARKKKGPGPVATAYLVIYNVVMTAGWLVIAVGL
VRAYLAKGSYHSLYYSIERPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWA
VTHSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYIIKWARYTLFIVLYPMGV
TGELLTIYAALPFVRQAGLYSISLPNKYNFSFDYHAFLILIMISYIPLFPQLYFHMIHQR
RKVLSHTEEHKKFE
NT seq 765 nt   +upstreamnt  +downstreamnt
atggcggcagcggcggcgactgcagcgaccaaggggaatgggggcggcagtggccgagtc
ggggctggcgacagcagcggcgcgcggaagaagaagggccccgggcctgtggccacggcg
tacctggtcatctacaatgtggtgatgacggcggggtggctggtgatagcagttgggctg
gtgagagcatacctggctaaggggagctaccatagcctttattattcaatagaaaggcct
ttgaagttcttccagacaggagccttactggagattttacattgtgctatagggattgtg
ccatcttctgttgtcctgacttctttccaggtgatgtcaagagttttcctaatatgggca
gtgacacatagtgtcaaagaggtgcagagtgaagacagtgtacttctgtttgtcattgcc
tggacaatcacggaaattatccgttactccttttacacattcagtctattaaaccatctg
ccttatatcatcaaatgggccaggtacacacttttcatcgtgctgtacccaatgggagtg
acaggagagctcctcacaatatacgcagctctgccctttgtccggcaggccggcctgtac
tccatcagcttacctaacaaatacaacttctcctttgattaccatgcattcctgattctg
atcatgatctcctacattccactgttcccccagttgtacttccacatgatacaccagaga
agaaaggtcctttctcacaccgaagaacataagaagtttgagtag

DBGET integrated database retrieval system