KEGG   Mus musculus (mouse): 70762
Entry
70762             CDS       T01002                                 

Symbol
Dclk2, 6330415M09Rik, AU044875, CL2, CLICK2, Clic, Click-II, Dcamk, Dcamkl2
Name
(RefSeq) doublecortin-like kinase 2
  KO
K08805  doublecortin-like kinase 1/2 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    70762 (Dclk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     70762 (Dclk2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  DCAMKL family
   70762 (Dclk2)
SSDB
Motif
Pfam: Pkinase DCX PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 70762
NCBI-ProteinID: NP_081815
MGI: 1918012
Ensembl: ENSMUSG00000028078
Vega: OTTMUSG00000051762
UniProt: Q6PGN3
Position
3; 3 F1
AA seq 756 aa
MASTRSIELEHFEERDKRPRPGSRRGAPSSSGGSSISGPKGNGLIPSPAHSAHCSFYRTR
TLQALSSEKKAKKARFYRNGDRYFKGLVFAISNDRFRSFDALLIELTRSLSDNVNLPQGV
RTIYTIDGSRKVTSLDELLEGESYVCASNEPFRKVDYTKNVNPNWSVNIKGGTTRTLAVA
SAKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAIKLDSGV
VKRLCTLDGKQVTCLQDFFGDDDVFIACGPEKYRYAQDDFVLDHSECRVLKSSYSRASAA
KYSGSRSPGFSRRSKSPASVNGTPSSQLSTPKSTKSSSSSPTSPGSFRGLKQISAQGRSS
SNVNGGPELDRCLSPEGVNGNRCSESFPLLEKYRIGKVIGDGNFAVVKECVDRYTGKEFA
LKIIDKAKCCGKEHLIENEVSILRRVKHPNIIMLVEEMETATDLFLVMELVKGGDLFDAI
TSSTKYTERDGSAMVYNLANALRYLHSLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLA
TVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDVWAAGVITYILLCGFPPFRSENNLQEDL
FDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGEILSHPWVSDDASQENNM
QAEVTGKLKQHFNNALPKQNSTTTGVSVIMNTALDKEGQIFCSKLCQDSSRPSREQTSPV
PPSAQEAPPPLESPRPPGPPATSGCDLAGTWRRHRD
NT seq 2271 nt   +upstreamnt  +downstreamnt
atggccagcacaaggagcattgagctggaacattttgaagaacgggacaaaaggccgcgg
ccagggtcacggagaggggctcccagctcctccgggggcagcagcatctctggccccaag
ggcaacgggctcatccccagcccggcgcacagtgctcactgcagcttctaccgcacgcgg
accttgcaggccctcagctcggagaagaaggccaagaaggcgcggttctaccggaatggg
gaccgctatttcaaaggcctggtctttgccatctccaacgaccgtttccgttccttcgat
gcgctcctcatagagctcacccgctcactgtctgacaatgtgaacctgccccagggcgtc
cgcaccatctacaccatagacggcagccggaaggtcaccagcctggacgagctgctggaa
ggtgaaagttacgtgtgtgcctccaacgaaccatttcgtaaagttgattacaccaaaaac
gttaatccgaactggtctgtgaacatcaagggcggaaccacccgcaccctggccgtggcc
tctgcgaagagtgaggtgaaagaaagcaaagacttcattaaacccaagttagtgactgtg
attcgaagcggagtgaagcctagaaaggccgtgcggatccttctgaataaaaagactgcc
cattcctttgagcaggtcttaacagatatcaccgaagccattaaactagactcaggcgtg
gtcaagaggctgtgcaccctggatggaaagcaggttacttgtctgcaagacttttttgga
gacgatgatgtttttattgcatgtggacctgaaaaatatcgttatgcccaagatgacttt
gtcctggatcatagcgaatgccgtgtcctgaaatcgtcctactctcgagcctcagctgcg
aagtattctggatccagaagcccagggttctcccgccgcagcaagtcaccagcttcagtg
aatggaactcccagtagccagctttccactccgaagtccaccaagtcctccagctcctct
ccaaccagcccgggaagtttcagaggattgaagcagatttctgctcagggcagatcttct
tccaacgtaaacggtgggcctgaacttgaccgttgcctgagccctgaaggtgtgaatgga
aaccggtgctccgagtcgttcccccttctggagaaatacagaatagggaaggtcatcggg
gacggcaacttcgcggtagttaaggagtgcgtggacaggtacactggaaaagagtttgca
ttaaagattatagacaaagccaaatgctgtggaaaggagcatctgattgagaacgaagtg
tcaatcctgcgccgagtgaagcaccccaacatcatcatgttggttgaagagatggaaaca
gcaactgacctctttctagtgatggaactggtcaaaggtggagatctctttgatgcgatt
acctcttcaaccaagtacactgagagagatggaagcgccatggtgtacaacctagccaat
gccctccggtacctgcacagcctcagcatcgtccacagggacatcaagcctgagaatctg
ctggtgtgcgaatacccagatggaaccaagtctttgaagctgggagactttgggctggcg
acggtggttgaaggcccgttgtacacggtctgtggcacgccaacttatgtggcaccagag
atcatagctgaaacaggttatggcctgaaggtggatgtttgggcagctggtgtgattaca
tacatacttctctgtggattcccaccattccggagtgagaacaatctccaggaagatctc
tttgaccagatcttggctggaaagctggaattcccagccccctactgggacaacattaca
gactctgccaaggagttaatcagtcaaatgcttcaggtaaacgttgaagctcgctgtact
gcgggagaaattctgagtcacccctgggtgtcagatgatgcatcccaggagaacaatatg
caagccgaggttacaggtaaactaaaacagcactttaataatgcgctccccaaacagaac
agcaccaccaccggggtctccgttatcatgaacacggctctagataaagaggggcagatt
ttctgcagcaagctctgtcaagacagcagcagaccatccagggagcagacctcgccagtc
cctccctcagcccaggaggcccctcccccactggagtctcccaggccccctggtcctcca
gccacctctggctgtgatctggcagggacctggcgccgccaccgagactga

DBGET integrated database retrieval system