KEGG   Mus musculus (house mouse): 70767
Entry
70767             CDS       T01002                                 
Symbol
Prpf3, 3632413F13Rik
Name
(RefSeq) pre-mRNA processing factor 3
  KO
K12843  U4/U6 small nuclear ribonucleoprotein PRP3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    70767 (Prpf3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    70767 (Prpf3)
Spliceosome [BR:mmu03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    70767 (Prpf3)
SSDB
Motif
Pfam: PRP3 DUF1115 PWI PROL5-SMR
Other DBs
NCBI-GeneID: 70767
NCBI-ProteinID: NP_001303680
MGI: 1918017
Ensembl: ENSMUSG00000015748
UniProt: Q922U1
Position
3:complement(95737436..95763197)
AA seq 683 aa
MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTL
RFVDKLFEAVEEGRSSRHSKSSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVE
EEPEVIPGPPSESPGMLTKLQIKQMMEAATRQIEERKKQLSFISPPAPQPKTPSSSQPER
LPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGI
APPKVELKDQTKPTPLILDEQGRTVDATGKEVELTHRMPTLKANIRAVKREQFKQQLKEK
PSEDMESNTFFDPRVSIAPSQRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAAR
KTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYIIPNGFDLTEENPKREDYFGITNLVEH
PAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLTPPPEPKVRISN
LMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQG
VHISVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLH
RIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENMAREH
FKKHGAEHYWDLALSESVLESTD
NT seq 2052 nt   +upstreamnt  +downstreamnt
atggcgctgtctaagcgggagctggatgagctgaagccatggatagagaagacggtgaag
agagtgctgggcttctcagagcccacagtggtcactgcagccttgaactgtgtggggaag
ggcatggacaaaaagaaggcggctgatcacctgaaaccttttcttgatgattccactctc
cgatttgtggataagctgtttgaggctgtggaggaaggccgaagctcaaggcattccaag
tctagcagtgacagaagcagaaagcgagagttaaaggaggtgtttggtgatgactctgag
atctcaaaggaatcatcgggggtaaagaagcggcggataccccgttttgaggaggtagaa
gaggagccagaggtgatccctggacctccatcagaaagccctggcatgctaacaaagctc
cagatcaaacagatgatggaagcagcaacacgacaaatcgaggaacggaaaaaacagctg
agcttcatcagcccccctgcacctcagccaaagacaccttcttcttcccaaccagagcga
cttcccatcggcaacactattcagccctcccaggccgctacctttatgaacgatgccatt
gagaaggcgaggaaagctgccgagctgcaagcccgaatccaggcccagctggcgttgaag
ccagggcttattggcaatgccaacatggtgggcctagctaatctccatgccatgggcata
gctccaccgaaagtagagttaaaagaccaaactaagcctaccccattgatcctggacgag
caaggccgcactgtggatgcgacaggcaaggaggtggagctcacacatcgcatgcccacc
ctgaaggcaaacattcgggctgtgaagagggaacagttcaagcagcagctaaaagaaaag
ccatcagaagacatggagtctaataccttttttgacccccgagtctcaattgccccttcc
cagcgccaaagacgcacttttaaattccatgacaagggcaaatttgagaaaattgctcaa
cgattacggacaaaggctcaattggagaagctgcaagcagagatttcacaagctgctaga
aaaacaggcattcatacttcgactagacttgccctcattgctcccaaaaaggagctaaag
gaaggcgatatccctgagattgagtggtgggactcgtacatcatacccaacggctttgac
cttacagaggaaaatcccaagagagaagattattttggaatcacaaatcttgttgaacat
ccagcccagcttaatcctccagttgacaatgatacaccagttacccttggggtatatctt
acgaagaaggagcagaagaaactacggaggcaaacaagaagggaagcacagaaagagcta
caagagaaagtcaggctaggcctgacacctcctccagagcccaaagtgagaatctcaaat
ttaatgcgagtattaggaacagaagcagttcaagaccctacaaaggtagaagcccatgtc
agagctcagatggcaaagagacagaaagcgcatgaagaggccaacgcggcccgaaaactt
acagcagaacagagaaaggtcaagaaaattaaaaagcttaaagaagacatttcacagggg
gtgcacatatctgtgtatagagttcgaaatttgagcaacccagccaagaagttcaagatt
gaggccaatgctgggcagctgtacctgacaggggtggtggtgctgcacaaagatgtcaac
gtggtggtagtggaagggggccccaaagcccagaagaaatttaagcgtctcatgctacat
cggataaagtgggatgagcagacatctaacacgaagggagatgatgatgaggaatctgat
gaagaagctgtgaagaaaactaacaaatgtgtactagtatgggagggtacagccaaagac
cggagctttggagagatgaagtttaaacagtgccctacagagaacatggctcgtgagcat
ttcaaaaagcatggggctgaacactactgggaccttgcactgagtgaatctgtgttggag
tccaccgactga

DBGET integrated database retrieval system