KEGG   Mus musculus (mouse): 70797
Entry
70797             CDS       T01002                                 

Gene name
Ankib1, 2310061P20Rik, 4631416I11Rik, AW494740, C80642, mKIAA1386
Definition
(RefSeq) ankyrin repeat and IBR domain containing 1
  KO
K11967  ankyrin repeat and IBR domain-containing protein 1 [EC:2.3.2.31]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    70797 (Ankib1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     70797 (Ankib1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    70797 (Ankib1)
SSDB
Motif
Pfam: IBR Ank_2 Ank Ank_5 Ank_4 Ank_3 zf-RING_UBOX zf-C3HC4_2 zf-RING_2 zf-C3HC4 zf-C3HC4_4
Other DBs
NCBI-GeneID: 70797
NCBI-ProteinID: NP_001003909
MGI: 1918047
Ensembl: ENSMUSG00000040351
Vega: OTTMUSG00000052985
UniProt: Q6ZPS6
Position
5; 5 A1
AA seq 1085 aa
MGNTTTKFRKALINGDENLACQIYENNPQLKESLDPNISYGEPYQHNTPLHYAARHGMNR
ILGTFLFGRDGNPNKRNVHNETSMHLLCMGPQIMISEGTLHPRLARPVEDDFRRADCLQM
ILQWKGAKLDQGEYERAAIDAVDNKKNTPLHYAAASGMKACVELLVKHGGDLFAENENRD
TPCDCAEKQQHKDLALSLESQMVFSRDPEAEEIEAEYAALDKREPYEGLRPQDLRRLKDM
LIVETADMLQAPLFTAEALLRAHDWDREKLLEAWMSNPENCCQRSGVQMPTPPPSGYNAW
DTLPSPRTPRTTRSSVTSPDEISLSPGDLDTSLCDICMCSISVFEDPVDMPCGHDFCRGC
WEAFLNLKIQEGEAHNIFCPAYECFQLVPVDVIESVVSKEMDKRYLQFDIKAFVENNPAI
KWCPTAGCERAVRLTKQGSNPSGSDTLSFPLLRAPAVDCGKGHLFCWECLGEAHEPCDCQ
TWKNWLQKITEMKPEELVGVSEAYEDAANCLWLLTNSKPCANCKSPIQKNEGCNHMQCAK
CKYDFCWICLEEWKKHSSSTGGYYRCTRYEVIQHVEEQSKEMTVEAEKKHKRFQELDRFM
HYYTRYKNHEHSYQLEQRLLKTAKEKMEQLSRALKETEGGCPDTTFIEDAVHVLLKTRRI
LKCSYPYGFFLEPKSTKKEIFELMQTDLEMVTEDLAQKVNRPYLRTPRHKIIRAACLVQQ
KRQEFLASVARGVAPADSPDAPRRSFAGGTWDWEYLGFASPEYRRRHRQQRRRGDVHSLL
SNPTDLDEPSESTFDLPEGSSGRRPGASVVSSASMSVLHSSSLRDYSPASRSANQDSLQA
LSSLDEDDPNILLAIQLSLQESGLDMDEETRDFLSNETSLGAIGSSLPSRLDSVPRSTES
PRAALSSSELLELGDSLMRLGADSDPFSTDTLSSRPLSETRSDFCPSSSDLDSAGQDPSA
NDNLLGNIMAWFHDMNPQSIALIPPAATTEISAEPQLPCIRDGSEGVRDMELVPPEDSVS
KDTGVHEGERAQMEENPLEENILAREELSQAGDSSNEAVGRGDRPDAASQTPQTSSDWLE
QVHSV
NT seq 3258 nt   +upstreamnt  +downstreamnt
atgggaaatacaaccaccaaattccgcaaagcactcatcaatggtgatgaaaatttggcc
tgccaaatatatgaaaataatcctcagctaaaagaatcccttgatcccaatatttcttat
ggagaaccctatcagcacaacacaccgttacactatgctgctagacatggaatgaataga
atattagggacttttctttttggtagagatggaaacccaaataaacggaatgtgcacaat
gaaacatctatgcatttgttgtgtatgggacctcaaatcatgatatctgaaggaaccctt
catcctcgcttagcacggcctgtggaagatgatttcagaagggcagattgtctgcagatg
atcttacagtggaaaggagcaaaacttgaccaaggcgaatatgagagagcggctattgat
gccgttgataacaaaaagaacacaccccttcactatgctgcagcctcggggatgaaagcc
tgtgtagagctcttagtaaaacatggaggagacttgtttgctgaaaatgaaaatagagat
actccttgtgattgtgccgaaaagcagcagcacaaagacctggccctcagtctggagtct
cagatggtgttctctcgggacccggaggccgaagaaatagaagcggagtatgctgcctta
gacaagcgagagccatatgaaggactaaggccccaggatcttcgtaggttaaaagatatg
cttattgtggagactgcagacatgctccaggcccctctgtttactgctgaagcactgctt
cgagctcacgattgggacagggagaagttgcttgaagcttggatgtccaacccagagaac
tgctgccagcggtcaggggtgcagatgccaaccccaccacccagtgggtacaatgcctgg
gacacgctgccttccccgagaactccaaggactacaagatcctctgtcacctccccagat
gaaatcagtctgtctcctggggatttagataccagtttgtgtgacatttgtatgtgcagt
atttctgtgtttgaagatccagtggatatgccctgtggacatgatttttgtagaggctgt
tgggaggcgtttttaaatctgaaaattcaagaaggtgaagcccataacattttctgccct
gcatatgaatgctttcaactcgtgcctgtagatgtcatagaaagtgtagtttctaaggag
atggacaaacgatacctacagtttgatattaaggcctttgttgaaaataatcctgccatt
aaatggtgtcctaccgcaggctgtgaacgagcagtcagactgacaaagcaggggtcaaat
ccatctgggtctgacacactcagcttcccattgctaagagcccctgctgtggactgcggc
aaaggacacctcttctgctgggagtgccttggtgaagcacatgagccttgtgactgccaa
acatggaaaaactggttacaaaagataaccgaaatgaagccagaagaactcgttggagtc
agcgaagcctatgaagatgctgccaattgtctgtggctgttaactaactccaagccttgt
gcgaactgtaagtctccaatacagaagaacgaaggctgtaatcacatgcagtgtgccaag
tgcaagtatgacttttgctggatttgcctagaagaatggaaaaaacatagttcttccact
ggaggttactacagatgcactcgctatgaagtcatccaacatgtggaggagcaatccaag
gagatgacagtggaggctgagaagaaacataaacggtttcaggaacttgacagatttatg
cactattatacaagatataaaaaccatgagcatagttatcagttagaacaacgccttctt
aaaacagccaaagaaaagatggagcagttgagtagagctctcaaagaaactgaaggaggc
tgtccagataccactttcatcgaagatgcagtgcatgttcttctaaaaactcggcgcatc
ctcaagtgttcttatccatatggatttttcttagaacctaaaagcacaaagaaagaaatt
tttgaactaatgcaaacagacctggaaatggtcactgaagaccttgcccagaaagtcaat
aggccttatcttcgtacacctcggcacaagatcatcagggcagcatgccttgtgcagcag
aaaaggcaagagttcctggcatctgtcgctcgtggtgttgctcctgcagactcaccagat
gctcccaggcgcagctttgccggtggaacatgggattgggaatatttaggatttgcttca
cctgagtatcggaggagacacagacagcagcgccgtcgaggagatgtgcatagcctgctc
agtaaccctacagacctggatgaaccaagcgaaagcactttcgatctcccagaggggagc
agcggccgcaggcctggtgcatctgtggtcagctctgcatcgatgagtgtgctgcacagc
tcttccctgcgagactacagccctgccagtcgctctgcaaaccaggactctcttcaggct
ctgagttccttggatgaagatgatcccaacatactcctggccatccagttgtcactgcaa
gagtctgggctggacatggatgaagagaccagagacttccttagtaacgagacatcccta
ggagccataggctcatctttaccttcccgactggactctgtgccccgcagcactgagtct
cctcgggctgcgctgagcagctcggagctgctggagcttggtgacagtctcatgagacta
ggagcagacagtgacccattttcaactgacactttgagttcacgccctctcagtgagaca
agaagtgatttctgtccctcttccagtgaccttgactcagctggccaggaccccagtgcc
aatgacaatcttcttggcaatattatggcttggtttcatgacatgaacccgcagagtatc
gccctgattcctccagcagcaaccacagaaattagtgctgagcctcagcttccttgtata
agagatgggtctgaaggtgtgagggacatggaactcgtgccaccagaagactcagtgtcc
aaagatactggtgttcatgaaggtgaaagagcccagatggaagaaaatcctctggaagag
aatattctggccagggaagagttgtctcaagctggtgacagtagtaacgaggcagtgggc
aggggggacaggccagatgctgccagtcaaacccctcagacctcaagcgactggctcgag
caagtacattcagtatga

DBGET integrated database retrieval system