KEGG   Mus musculus (house mouse): 70799
Entry
70799             CDS       T01002                                 
Symbol
Cep192, 4631422C13Rik, D430014P18Rik
Name
(RefSeq) centrosomal protein 192
  KO
K16725  centrosomal protein CEP192
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    70799 (Cep192)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    70799 (Cep192)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     70799 (Cep192)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     70799 (Cep192)
SSDB
Motif
Pfam: ASH TMEM131_like_N MYCBPAP Motile_Sperm DUF5827
Other DBs
NCBI-GeneID: 70799
NCBI-ProteinID: NP_081832
MGI: 1918049
Ensembl: ENSMUSG00000024542
UniProt: Q8C769 Q6P2K8 E9Q4Y4
Position
18:67933124..68018241
AA seq 2514 aa
MEDFRGIAEESFPSFLANSLLGNSEVLGNVTLSSNFGLPIAVSTLARSRPSTDNRCPDVQ
ESYLIEERFSVPSASSPSCQSDNPEPRERLRLSFQGDDSALRKKNYIESPDLSHALMKPR
AEEKQANAASVQGQSLLGGVSPLQQVPDSALDFHLKSWTNHEEHNIAMPDPKKHFEAVNP
NRDFSHTSLLDNEKLLTLTNLDSSSDDDINDEEFYDDHLEAYFEQLAIPGMMYEAGGQES
PADDFKFPANEDSILNCEFQSENNSPRLPHDACTSGNSPTAHTESEGGHGCPPGTSGCVG
TVDNKMQVDNVMSLYSHAWRNEKEAAHNLKDIVPNQSRGCGGEEIVVKRLCAVDETLRST
YRHSTETEDGFDPADYIKQDSESPHQNKHFASDLETVPNVDRCLNTETPTVFIQKDGDIA
ASSKTNGDNGINSPDTLWSPTSERRACGLYESDSKTSDKGELSQNVVYKSEDGRWVTDLA
YYTSFIDQQDLQMSPNNEMNEDFRSGSDALDLIAKDEEEFNKEHPFIQDEKIDVQNTPVA
LGDNSWVATVNYHLLRKSLGTSDFDKDNGSYLRLSLGEFFAERSEALGCLGGGKDVKRPS
FGYFIRSPEEREPVALIKSDLSRSDLEKEATQPYRGFSSGDLNEQSQVQLSEGSVMLKAE
ELQRNSQVDEDDITLTASRNQTEDTLCSNNKLQEYKNTLSGGEDSVLRISTIASAFADVS
VSTDPAQLVTMMKALRNKGRSKPFQDDGTQEDCPNISHVLLNDLEKSNRSNAFDMEKYLT
KTEFSSCEGAREPLSRAGTSDMWDLCSPERQTVQDRSMVNVCATNSREAEETTAAIFCAE
NIESDTQESLRTIASSDSVLTSTRENRNSAMGRMPPSVDTLLDVRNSEKAASVSIAASRS
DSLLRNPRVPSFSIVEQCEEIQDNRDHGRKKECVSETSSSDKHVTFEDGLVVLPKSVDLK
TASPESGRSGFQDEESFRLSPLSHSSPSEISGNFAGCVLESLDSAYHQRPHLESELSQLA
CSHADMSRLTYVSEQENTFPVTAADESSEDHKSDLTSELSTTIVRASPTPPREQAVEKPR
DKIPGQNAEKVSMPWVIQSKSGLANMRETPSLRTGFEDGEPNFTSSQDISSESREPLEAG
KMMDSTSGSSEQDLIGQALLDKPALNHRSGPAVPNLPELIQKTVDQGQRLSSTRLSAASS
EASSQVPNPGASGTQHNPAPHISAHASVAKVMNQPAVCPALWTGHSLYIAPGAPSGNATL
SQCHAGMQVCGISGYSPYPAAAPELVASGLYLGPSLASGLMAPSSLYNLCSTAAPQNLLS
TAKPFPMVTNCETEPRDSGMMPAFGNARVPEELRFPHACCVGIASQTLLSVLNPTDHWLQ
VSIRVLSIWVNGEKVDLSTQTCLVFKNKVVIRPQATEEIKILFIPTSSGIFRCTFSVASW
LFSADADTVGQAEALGSRVTLTAIAETPVIEVETEKKGVLDFGDLTYAGWKALPLKLINR
THATVPIRLIINANAVAWRCFTFSKEPIHVSLKAAPHADITAQLAAPSVVSHVMPASYDG
KDPEFLVVWVIFHSPKKLLTSEILGSAEEFLARVDIEVDSPNPIPVLRSVALRARAGVAR
IHAPRDLQTVYLLADVNSSTKHPLPLKNAGNIEVHLDIKVAEQGSQFSVDPESLFLRPGE
EHEVTISFTPKDSKACEERILIIFVQPLGPQYEVVLRGEVISSGSKPLPPGPHCSDIPLI
LSNKQFLTWGGIPLGRTQLQKLALRNSSTTTAQNLRLFIKGQDQDCFQIQNTFGSEERLT
SNCEIRICPGEDFVISVLFAPTRLSCMLAKLEIKQLGSRSQPGIKFMIPLSGYGGTSNLI
LEDVKKLSDSYLITMNDLIPGKESKVVFSIRNTGSRAAFVRAVCFKESQRKVLLDPKVLR
IFPDKFVLKERTQEHITLVYTPSSRKNGEKPATELLTVYMFGGDEISRQQYRRAQMHTPG
ILKQILPEHSVLQHIDFTEAFQDEPLIDEVCDLPQRPNDIELFYGSMRKITLSVIGEFRG
TICSREFLQPSSSAESKSNFSSDSKTSGKQSGNVLLDVLPVKGPQGPPFLSQSAHPAQDT
AASEEGWAVHPEHLILVAPSSCDLAKTGCFQIINNSVILLKFELYWPAHCLTVTPQHGCI
MPESKIQILVSPNFSVSTKESVCPWTGLIYIHCDNGQKKIVKVQIREDLTQEPLPHLPSS
GTSGILAPAPEPSISRLTKLITKPPSTKVEIRSKTVIFPPTEPGRTSENYLELENCGPTD
VKWHLSSFAPPYVKGVDETEDVFRATYTTFRCSPISGTLEGHGIQKVSIIFLPRDKGNYA
QFWDVECHPAKEPHMKHTLRFQLSGQSIRAENDPEDSCSSRDALIKVDTAVTSRRRAVSE
TAAHTPGQLNSSHHGVYAPKDVYTFLPTKLGESRTLKINLRNNSFSTHALKFLSPREPFH
IRHSKYTLRARHYIHIPVHFRPEAVGRFEALLVIQTDEGKSIAIRLIGESLGKS
NT seq 7545 nt   +upstreamnt  +downstreamnt
atggaagatttccgaggaatagcagaagagtcatttccaagctttttagccaattcacta
cttggtaatagtgaggttttgggaaatgtcactctttcatcaaattttggcttgcccatt
gctgtttctacacttgccaggagcagacccagcactgacaacaggtgtcctgatgtccag
gaatcatacttaattgaagagaggttttcagttccttctgcatcatctcccagttgccag
agtgacaaccctgagccaagagaaagattacgactcagctttcagggtgatgattctgct
ctaaggaaaaagaactacatagaaagtccagatttgtcacatgctctcatgaaaccaaga
gcagaagagaagcaagctaacgctgcgtctgttcagggccagagccttctgggtggagtt
tctcctctgcaacaggtaccagattcagctcttgatttccacttaaaatcatggacaaat
catgaagagcacaatattgccatgcctgatcctaagaagcatttcgaagccgtgaatcca
aaccgtgatttcagccataccagcttattagacaatgaaaaactgttaacactgacaaac
ttggacagttcctctgatgatgatattaatgatgaagaattttatgatgatcatttagaa
gcatattttgagcaactagccattccagggatgatgtatgaagcaggaggacaggagtcg
ccagcagatgattttaagttccccgcaaatgaagacagtatcttaaactgtgagtttcaa
tcagaaaataacagtcctcggcttcctcatgatgcatgcacctcaggaaattctcctact
gctcacacagagtctgagggaggccatggttgtccgccgggaactagtggctgtgtaggt
actgtcgataataaaatgcaggtagataatgtgatgtcactttattctcatgcctggaga
aatgagaaggaagcggcacacaatttgaaggatattgttccaaatcaaagcagaggatgt
ggaggagaggagattgtggtgaagaggctgtgtgctgtggatgagaccctcagatctact
tatcgtcacagcacagaaacagaagacggctttgacccagctgactatatcaaacaggat
tcagaatctcctcaccaaaataagcattttgcttcagatttagaaacagttccgaacgtg
gatagatgtttaaatacagagactcctacagtgtttattcaaaaagatggagacattgct
gcatcttcgaagactaatggtgacaatggaattaattctcctgatacgctttggtcacca
acttctgaaaggagagcatgtggactttatgagtccgattcaaagactagtgacaaagga
gagctctcacagaatgtcgtctacaaaagtgaggacggaagatgggtcactgaccttgcc
tactacacatcttttattgatcaacaagatttacagatgtctccaaataatgaaatgaat
gaagacttcagatctggttctgacgcattggacttaattgcaaaagatgaagaagaattc
aataaagaacatccatttatacaggatgaaaaaatagatgttcagaacactccagtggca
cttggtgataattcctgggtagcgacagttaattaccatttattgagaaaatcacttggc
acatcagattttgataaagacaatggcagttatctacgcctttcattaggagagttcttt
gcagaaagatctgaagctcttggttgccttggtggtggtaaggatgtgaaaagaccatca
tttggttattttattagatcaccagaggagagagaacctgttgcgttaataaaatctgat
ttgtcaagaagtgatttggagaaagaagcaactcagccttaccgtggtttctcttcagga
gacttaaatgaacagtcccaggtacagctaagtgaaggatcggttatgctcaaggctgaa
gaactgcagagaaattcccaggtggatgaagatgacattacactaactgccagcagaaac
cagacagaggacactctctgtagtaataacaagcttcaggaatataagaacacactgtct
ggtggtgaagattctgtacttagaataagcaccattgcttccgccttcgcagacgtgtca
gtgagcactgatcctgcccagcttgttaccatgatgaaagcactcagaaataagggaaga
agcaagccttttcaggatgatgggacacaagaggactgtccaaacatctctcatgtctta
cttaatgatttagaaaaaagtaatagatccaatgcatttgatatggagaaataccttaca
aaaacagaatttagtagctgtgaaggtgcacgagagcccctttcaagagcaggcacatct
gacatgtgggatttatgttcgcccgaacggcagactgttcaagacaggagtatggtgaac
gtttgtgctactaattcaagggaagcagaagaaactacagctgctattttctgtgcagaa
aatatagagagtgatactcaagaatcccttagaacaatagcctcctcagattcagtcctc
acaagcacgagagagaatagaaactcagccatggggaggatgccaccctctgttgacact
ttactggatgtgcggaacagtgagaaagctgcctcagtttccattgcagcgtccaggagt
gactcactactgaggaaccccagagtaccttcctttagcatcgtagaacagtgtgaggaa
atacaagataaccgagaccatggaaggaagaaagagtgtgtcagcgagacaagcagcagt
gacaagcacgtcacctttgaagacggtcttgtggtcttacctaaaagtgttgatttgaaa
actgcctctcctgagagtggtagatctggctttcaagacgaggagagcttcaggctgtca
ccactcagtcattcttctcccagtgaaatttctggaaacttcgcaggatgtgttctggag
tctcttgattcagcttaccaccagagaccccacttagagagtgagttgtctcagttggca
tgttcccatgctgacatgagcaggctgacttacgtatctgagcaggaaaatacctttcct
gtcacagctgctgatgaaagctcagaggaccacaagagtgatctcaccagtgagctgagt
accacaattgtccgagccagtcctactccaccaagggaacaagctgtggaaaaaccaaga
gacaaaattccaggtcagaatgcagaaaaagtatccatgccctgggttatccagagtaaa
tctggtttagcaaacatgagagaaactccttctctgaggaccggatttgaagatggagaa
cctaactttacatccagtcaagatatttcttccgaaagtagggaacccttggaagctggt
aagatgatggattcaacatctggctccagtgagcaggacctgattggccaagctctcctg
gacaagccagctctaaaccaccggtctgggccagctgtaccgaacctccctgagttgatc
cagaagactgtggatcaaggtcaaagattatcatctactcgtctgtcagctgccagcagt
gaagctagcagccaggttcctaatccgggtgcctctggaacccagcacaatcctgcaccc
cacatttcagctcatgcttctgttgctaaggtgatgaaccagcctgctgtgtgtcctgcc
ctctggactgggcactctctatacatagctcctggcgccccatctgggaatgccaccttg
tcacagtgccatgcaggcatgcaggtctgtgggatttcagggtattctccgtatcctgct
gctgcaccagagcttgtggcttctgggctgtacttaggaccaagtcttgcctctggattg
atggctccctcttctctttacaacctgtgctctactgctgcaccccagaacttgcttagt
acagcaaagccatttcctatggttacaaactgtgaaactgagccacgggactcagggatg
atgcctgcgtttgggaatgccagagtgcccgaggagctgaggttccctcacgcttgctgt
gtaggcattgcttcacagaccctccttagtgtcctcaaccccactgaccactggctgcaa
gtcagcatcagagttctcagtatctgggtgaatggtgagaaggtggatctttcaacacag
acctgtttagttttcaagaataaagttgtgataagacctcaagctacagaagagataaaa
attctttttatccccacaagttctgggattttcagatgcacgttcagtgttgcttcttgg
ttgttttcagcagatgctgacacggtagggcaggcagaggctctgggaagcagagttact
ctcactgccattgctgaaacccctgttatcgaggtagaaacagaaaagaaaggtgttctg
gattttggtgacttgacctatgcaggctggaaagctctcccactcaagttaataaatagg
acacatgctactgtgccaatcagattgattattaatgctaatgccgtagcctggcgctgt
ttcacgttttccaaagagcccatccatgtgtctctgaaagctgctccgcatgctgacatt
actgctcagctagcagccccgtccgtagtcagtcacgtgatgcctgccagttacgacgga
aaggatccagaatttctggtagtttgggttattttccatagcccaaagaaactcctcact
tcagaaattctaggctcagcagaagaattcttggccagagtggatatagaagtggacagc
ccaaaccctattcctgttctgagaagcgtggccctccgagcacgagcaggagtagctagg
atccatgcccctcgggatttgcagactgtgtatttgttggctgatgtgaattcctcaaca
aagcatcccttgcctttgaaaaatgctgggaatattgaagttcatctagatatcaaggtc
gctgagcaaggaagtcagttttcagtggacccagagagtttgtttcttagacctggagaa
gaacatgaagttacaatttcctttacaccaaaggattccaaagcctgtgaggaaaggatc
ctgataatatttgtgcagccgttaggacctcagtatgaagtggtgttacgaggtgaagtc
atttcttctgggagtaaacctctgccacctgggcctcactgctcagatattccactgata
ctgtccaataagcagtttctgacttggggtggcatccctctcggcaggacacagctccag
aaactagctttaagaaacagttctacaactacagcccaaaatttgcgactatttatcaaa
ggacaagatcaggattgctttcagattcagaacacttttggctcagaagagcggctgacc
agcaattgtgagatcaggatttgcccaggggaggactttgtaatctctgtgttatttgca
cctactcgattatcttgcatgttggctaaacttgaaatcaagcaacttggaagtcgatct
cagccaggcattaagtttatgataccattgtctggatatggaggaacaagtaatcttatt
ttagaagatgttaagaaattatctgacagttacttgataacaatgaatgacttaattcct
ggcaaagaaagtaaagttgttttttctattcgcaacactggctccagagcagcctttgtt
agagcagtatgttttaaagagtctcaaagaaaagttttgctggatcctaaagtattgagg
atttttccagataaatttgtacttaaggaaagaacccaagaacatattactttagtgtac
actccatcaagcagaaagaatggcgaaaaacctgcaacagagctgttaactgtctacatg
tttggtggtgatgaaatctccagacagcagtatcgcagagctcagatgcatacaccagga
atcctaaagcagatccttccagaacacagtgtgctacagcacatcgacttcacggaggca
tttcaggatgagcctctcattgatgaagtgtgtgatcttcctcagcggcctaatgacatt
gagctcttctatggaagcatgcggaaaattaccctgtcagtaattggagaattcagaggt
accatttgtagccgagaatttcttcagccttcctccagtgctgaatccaaaagtaatttc
tccagtgactctaaaacttctggaaaacaaagtggcaatgtcctgttggatgttttaccg
gttaaaggccctcaaggccctccttttctctcacagtctgcccacccagcccaggacaca
gcagcctctgaagaaggctgggctgtccatccagaacacttgattctggtggctccttcc
tcttgtgatttggcaaaaactggatgtttccaaattataaataattctgttattttactg
aaatttgagctgtactggcctgcacattgcctgacagtcacaccacaacatggatgtatc
atgccagagagtaaaatacaaattctcgtgagtcctaatttttccgtgtccacaaaagag
tcagtgtgcccatggactggtttgatctacatacactgtgataacggacagaagaaaatt
gtaaaagttcaaattcgagaagatttgactcaagaacctttacctcacttgccctcctcc
ggtacatctggaattcttgcccctgcacccgagccttccattagtcgtttgacaaaacta
ataacaaaaccaccttccacaaaagttgaaattagaagcaagacagtgatttttcctcca
acagaacctggtagaacctcagagaactatctggaactggagaattgtggccccacagat
gtaaagtggcacctgtcatcttttgcacccccgtatgtcaagggagttgatgaaactgaa
gatgtttttcgagctacctacacaaccttcagatgttctcccatttctggcacactagaa
ggccatggaatccaaaaggtctccatcatatttttgcccagagacaaagggaattatgcc
cagttttgggatgttgagtgccaccctgctaaagaacctcacatgaaacatacattgaga
ttccagctctctggccagagcatcagagcagagaatgaccctgaagactcatgctcctcc
agagatgccctcattaaagtagataccgcagtcacatcccggaggcgcgctgtgtctgag
acagctgctcacacgcctgggcagctcaactcgagccatcatggagtatatgccccaaag
gatgtctacacgttcctgccaaccaaacttggggaatccaggacactgaaaatcaatttg
agaaataattctttttccactcatgcactgaagtttttgagccccagagaacctttccac
attagacactccaagtacactttgagggcccgacattatatccacatcccggtgcacttc
agaccagaggcagtgggcagatttgaagctttacttgtgatccaaacagatgaaggcaag
agtattgctattcgactaatcggtgaatcccttggaaaaagttaa

DBGET integrated database retrieval system