KEGG   Mus musculus (mouse): 70802Help
Entry
70802             CDS       T01002                                 

Gene name
Pwwp2a, 4631424J17Rik, AI891583, AU024105, D930040F23Rik
Definition
(RefSeq) PWWP domain containing 2A
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SPACA7
Motif
Other DBs
NCBI-GeneID: 70802
NCBI-ProteinID: NP_081833
MGI: 1918052
Ensembl: ENSMUSG00000044950
Vega: OTTMUSG00000005461
UniProt: Q69Z61
Position
11; 11 B1.1
AA seq 730 aa AA seqDB search
MAAVAAEAAATAASPGEGGAGEAEPELEPIPGSEAGTPLPVTATEAAVPDGEADGRQSAP
QADEQPLPPPPPPPPPGELADSSEAEEAKPPEPAAVPVSPPEQPPAAPEQPEDAPRPPPA
PALVPPAGGDSAVSHLIPGSEVRVTLDHIIEDALVVSFRLGEKLFSGVLMDLSKRFGPHG
IPVTVFPKREYKDKPDAMQLQSTTFQEGIEVKQEVNGAVPDDLSPVPPPERLWASKPPPL
FHEGAPYPPPLFIRDTYNQSIPQPPPRKIKRPKRKMYREEPTSIMNAIKLRPRQVLCDKC
KNSVVAEKKEIRKGSSDSSRYEDKKRRNDSVATVNKKLKTDHKVDGKNQNESQRRNTVVR
VSSIAHSRGRVVKVSAQANTSKAQLNTKKVLQSKNMDHAKAREVLKIAKEKAQKKQSETS
TSKTAHAKVHFTRRYQSPSSGSLPPRVRLKPQRYRNEENDSSLKTGLEKIRSGKLAPKPQ
SRCTSTRSAGEAPSEKPSPSEGPEESAGEVQDTSRVRVPGEQEELRMLGKKGSKSSISVY
LTLNQETSDSSSASVCSIDSMDDLKSSNSECSSSESFVFPPGCMHAPSASSTSTSFSSKE
ENSLRNSLKMKIFSKNVSKCITPDGRTICVGDIVWAKIYGFPWWPARILTITVSRKDNGL
LARQEARISWFASPTTSSLALSQLSPFLENFQLRFNKKRKGLYRRAITEAAKAAKQLTPE
VRALLTQFET
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtggctgctgaggcggcggcgaccgcggcgtcccccggggaagggggcgcc
ggcgaggccgagccggagctagagcccattcccggcagcgaagccggcacccccctcccg
gtcacggccacggaggcggcggtgccggacggcgaggccgacgggcgccagtccgcccct
caggccgacgagcagccgctgccgccaccgccgccgccgccgccgccgggggagctggcc
gatagctccgaggctgaggaggcgaagccgcccgagcccgcggctgtcccggtctcgccg
cccgagcagcctccggccgcccccgagcagcccgaggacgcgccgcggccgccaccagct
ccggcgctcgtgccgccggcgggcggggactcggcggtgtcgcacctcatccccggctcg
gaggtgcgggtcacgctggaccacatcatcgaggacgcgctcgtcgtgtcgttccgcctc
ggggagaagctcttctccggggtcctcatggacctatccaaaaggtttgggccccatggg
atccctgtgacagtatttcccaaaagggaatataaggacaaaccggacgccatgcagctc
caaagtaccacattccaagaagggatagaagtcaagcaggaagtgaacggtgctgttccc
gatgacctctctccagtccctcctcctgagcgcctgtgggcttccaagccacctcctctc
ttccatgaaggagcaccttaccctccccccttgtttatcagggacacatataaccaatca
atacctcagccgccgcctcggaaaattaagcgacccaaacgaaaaatgtacagggaagaa
cccacttcaataatgaatgcgattaagctacggcccaggcaagtcctgtgtgataagtgt
aaaaacagtgttgttgctgaaaagaaggaaattaggaaaggtagcagtgactcttctagg
tatgaagataaaaaacggagaaatgacagtgtagctactgtgaacaaaaaactgaaaact
gaccataaagtggatgggaaaaaccaaaacgaaagccagagaaggaacactgtggtgagg
gtttccagtatcgctcacagcaggggcagagtagtcaaggtttctgctcaggcaaataca
tcaaaagctcagttaaataccaagaaagtgctccaaagcaagaacatggatcacgcaaaa
gctcgggaagtattgaaaattgccaaagaaaaggcacagaagaagcaaagtgaaacctcc
acttccaaaaccgcccatgcgaaagtccacttcacacgtcggtatcagagtcccagctca
ggttctctcccaccccgagtgcggttaaaaccacaaaggtacaggaacgaagaaaatgac
tcttctctgaagacgggactggagaaaattcggagtggcaagctggcgcctaagccgcag
tctcgatgcacctccacccgctcagcaggtgaggccccttcagaaaaaccgagtccctca
gaaggcccggaagagtccgccggtgaggttcaggacacaagcagagtgcgtgtgcctggt
gagcaggaggaactgcggatgttgggcaaaaagggcagcaaaagcagtatctctgtttac
ctgaccctaaatcaggagacatctgactcttccagtgcctcagtgtgtagcattgatagc
atggatgatttgaaatcctccaactctgagtgtagctcttctgagagcttcgtttttcct
cccggctgtatgcacgcaccttctgcctcttccacttctacttccttctcttcaaaggaa
gagaatagcctccgtaattctttgaaaatgaaaatcttttcaaaaaatgtctctaaatgt
atcacaccagatggcaggaccatatgtgtaggggacattgtttgggccaagatatatggc
ttcccttggtggccagcccgtattcttaccatcactgtaagccggaaagataacggcctt
ttagcccggcaggaggcccgtatctcatggtttgcatctccaaccacatcttcccttgct
ctctcacaactctccccctttctagaaaacttccagttacggtttaataagaagagaaag
ggtctgtatcgcagggctatcacagaggctgctaaggctgctaagcagctgacccctgaa
gtgcgggctttgttgacacaatttgaaacgtga

DBGET integrated database retrieval system