KEGG   Mus musculus (mouse): 70839
Entry
70839             CDS       T01002                                 

Gene name
P2ry12, 2900079B22Rik, 4921504D23Rik, P2Y1, P2Y12
Definition
(RefSeq) purinergic receptor P2Y, G-protein coupled 12
  KO
K04298  P2Y purinoceptor 12
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    70839 (P2ry12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    70839 (P2ry12)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    70839 (P2ry12)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 70839
NCBI-ProteinID: NP_081847
MGI: 1918089
Ensembl: ENSMUSG00000036353
Vega: OTTMUSG00000052355
UniProt: Q9CPV9 Q546L4
Position
3; 3 D
AA seq 347 aa
MDVPGVNTTSANTTFSPGTSTLCVRDYKITQVLFPLLYTVLFFAGLITNSLAMRIFFQIR
SKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGAGPLRTLVCQVTSVTFYFTMYISISF
LGLITIDRYLKTTRPFKTSSPSNLLGAKILSVVIWAFMFLISLPNMILTNRRPKDKDVTK
CSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYSLITKELYRSYVRTRGSAKVPKKKV
NVKVFIIIAVFFICFVPFHFARIPYTLSQTRAVFDCSAENTLFYVKESTLWLTSLNACLD
PFIYFFLCKSFRNSLTSMLRCSNSTSTSGTNKKKGQEGGEPSEETPM
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggatgtgcctggtgtcaacaccacctcagccaataccaccttctcccctgggaccagc
accctgtgcgtcagagactacaagatcacccaggttctcttcccattgctgtacaccgtc
ctgttctttgctgggctcatcacgaacagcttggcaatgaggattttctttcagatccgc
agtaaatccaacttcatcatttttcttaagaacacggtcatctctgatctactaatgatt
ctaacttttccatttaaaattcttagtgatgctaaactgggagccgggcctctgagaacc
ttggtgtgccaagttacttcagtcacattttattttacaatgtatatcagtatatcgttc
ctggggttgataaccattgaccgctacctgaagaccaccaggccatttaaaacgtccagc
cccagcaatctcttgggtgcaaagattctttctgttgtcatctgggccttcatgttctta
atttcactgcctaacatgattctcaccaacaggaggccaaaagataaggacgtaacaaaa
tgttctttcttaaagtcagagtttggtctagtttggcacgaaatagtcaattacatctgc
caagtcattttctggattaattttttaattgtcatcgtttgttatagcctcattaccaaa
gaactctatcggtcttatgtcagaacaaggggttcagccaaagttcccaagaaaaaggta
aacgtcaaggttttcatcatcattgctgtattctttatttgctttgttcccttccacttt
gcacggattccctacaccctgagccaaactcgggccgtctttgactgcagtgctgagaac
accctgttctacgtgaaggagagcaccctatggctgacgtcactgaacgcctgccttgat
ccattcatctacttttttctttgcaagtctttcagaaattccttgacaagcatgctgagg
tgctcaaactctacatcaacatctgggacaaacaagaagaaaggacaagaaggtggcgaa
ccaagcgaagagaccccaatgtag

DBGET integrated database retrieval system