KEGG   Mus musculus (mouse): 70881Help
Entry
70881             CDS       T01002                                 

Gene name
Nt5c1b, 4921514H13Rik, AIRP, CN-IB, cN1B
Definition
(RefSeq) 5'-nucleotidase, cytosolic IB
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu00240  Pyrimidine metabolism
mmu00760  Nicotinate and nicotinamide metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    70881 (Nt5c1b)
   00240 Pyrimidine metabolism
    70881 (Nt5c1b)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    70881 (Nt5c1b)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     70881 (Nt5c1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5-nucleotidase
Motif
Other DBs
NCBI-GeneID: 70881
NCBI-ProteinID: NP_081864
MGI: 1918131
Ensembl: ENSMUSG00000020622
Vega: OTTMUSG00000027551
UniProt: Q91YE9
Position
12; 12 A1.1
AA seq 573 aa AA seqDB search
MSQTSLKHKKKNEPGMRYSKESLDAEKRKDSDKTGARLSTQGSQELPLHNTDSRGYVVRN
QWSRTSRSPSTGAPSVDEPRSRNTAIKVEAPNSSTTSRTSSASPSQHETSPPPQTSEKSS
IQQTPQNRPITQLESQPPTPPETEPNSRRTSAKMYTGSDPWAHRENREPRDLQLRDYAYS
CDSREGMPKTREYPRTPPTEWKPYAQRRLQYGTSVDMEPEYISDGPQQRQRQQTEEDEVD
EAYWTSVSMLYEKIPSCARPRPPKPKHAITIAVSSRALFNMVDDRKIYEEEGLEKYMEYQ
LTNENVILTPGPAFRFVKALQHVNSRLRDLYPDEQDLFDIVLMTNNHAQVGVRLINSVNH
YGLLIDRFCLTGGKSPIGYLKAYLTNLYLSADSEKVQEAIKEGIASATMYAGAKDMAYCD
TQLRVAFDGDAVLFSDESEHIAKDHGLDKFFQHETLFENKPLAQGPLKSFLEDLGKLQKK
FYAKDERLLCPIRTYLVTARSAASSGARVLKTLRRWGLEIDEALFLAGAPKGPILVKIRP
HIFFDDQMFHIESAQKFGTITAHVPYGIAQKRN
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaacatccttgaaacacaaaaagaaaaatgaacctggaatgaggtactcaaaa
gagagtctagatgcagagaaaagaaaggattctgacaaaactggagctcgtctgagcact
cagggatcccaagaattacctctgcataatacagactcccgaggttacgttgtacgaaat
cagtggtcccgaacatcacggagcccatctactggagctccatcagtggatgagcccaga
agcaggaatactgccatcaaggtagaggcccctaacagctccactacctctcgaacttcc
tctgcctcccccagtcaacacgagacctcacctccacctcagacatcagagaagtcctcc
attcaacagaccccccagaacagacctatcacccagcttgaatcacaacctcccacacct
ccggaaacagagccaaactcgagacgaacatcggcgaagatgtatacgggcagtgatccg
tgggcgcacagggaaaacagagagcctagagacttgcagctgagggactatgcatacagc
tgtgactcacgagaagggatgcccaagacccgagagtatccgcgcactcctcctactgag
tggaagccctatgcccagcgtcgcctccagtatggcacctctgtggacatggaaccggaa
tatatatccgatggcccgcagcagaggcagaggcagcagacagaggaagatgaggtggat
gaggcctactggacatctgtgagcatgctgtatgagaagatccccagctgtgcacggccc
aggccgcccaaacccaagcatgccatcaccattgccgtctcttctcgggcacttttcaat
atggtagatgacaggaaaatctacgaagaggaaggtctggagaagtacatggagtatcag
ctcaccaacgagaacgtcatcctgacgccagggccagcgttccggtttgtcaaggcactg
cagcatgtcaactctagactccgtgatctgtatcctgacgaacaggacttattcgatata
gtactgatgactaataaccatgcccaagtgggagtaaggcttataaacagcgtcaatcac
tatggtctactgattgaccgcttctgtttgacgggtgggaaaagccccattggatatttg
aaggcatatcttaccaacctgtatctttctgctgattctgaaaaagtacaagaagcaata
aaagaaggtattgcctctgcaaccatgtatgctggagccaaagacatggcttattgcgac
acacagctacgcgtggcctttgatggggatgctgtcctcttctcagatgaatctgaacat
attgccaaggatcatgggctggacaaatttttccaacatgaaacactatttgagaataag
cctcttgctcagggtcctcttaaaagctttctggaagatttagggaaactgcagaaaaaa
ttctatgccaaagacgaacgattgctttgccccatcaggacctacctggttacagctcgt
agtgcagcgagttcaggtgcccgtgtgctgaagacccttcgccgatggggtctagagata
gatgaagctcttttcctggctggagcccctaaaggtcccatcttagtgaagattcggccc
cacatcttcttcgacgaccaaatgttccacattgaatcagcacagaaatttggtaccatc
acggcccatgtgccttatggcattgctcaaaaacgcaactag

DBGET integrated database retrieval system