KEGG   Mus musculus (house mouse): 70884
Entry
70884             CDS       T01002                                 
Symbol
Ccdc81, 4921513D09Rik
Name
(RefSeq) coiled-coil domain containing 81
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: HU-CCDC81_euk_2 HU-CCDC81_euk_1 Bac_DNA_binding
Other DBs
NCBI-GeneID: 70884
NCBI-ProteinID: NP_001156451
MGI: 1918134
Ensembl: ENSMUSG00000039391
UniProt: Q9D5W4
Position
7:complement(89515356..89552837)
AA seq 654 aa
MLDRVGPGFQDLCRQVLPTLPTLSQEEVSTIWANVSDFVERQLTMHKGVQISGLGTFTFS
RQQLEVGNKKFVLVQRPVFIMAEKLVQTHGLKQNKVFSPGDIPVVPLNFVMISLEGPFNR
DTIEGCVKETLLFLSRSISVKQKVEFTFKGIGVLSIRDSKVKMRFYKDFLCSMDGSGILT
KALANRPGTMDSVLSSRESYRKRPNSAMAFPRIEHKETENKTPVEVVGEEGGENRPRKIK
LKDQSDKEGGAREISSPKKHRERQSISPAKVTSVSLLDKFERSGNGGKITACENLSSPGC
QRNDNERPRTSPAPACQDHNKAGQEMCYVCLQRAQRNFALHYGDERRRREIEDERLMQQY
QILKDQEAFFKNQVKGMAAREQNQKNAAYNLGVAEAIRNHKNEKPEFYKSFLFDKRPLSP
EINAFKQEEYSQSLLKQMESKREKEIKQRQNRELMDRLEQVQLTEELAAQRAQYLKEKME
ETQHYKRALDAQVKNKPPQLPMFEPDSAEPIFGKNDGEREMEKRKREQSCMKHQMEAAAS
HKRNTILNQLVDQRRDLQMLQRTQREHMADRAAEMDRVNRLNQCLQEDWDRSLAMKKQRD
VEEKAFERASDKLFLLDQCEKYRRCRQCQRRTCNTGESNLWPMNKFLQGSRLLV
NT seq 1965 nt   +upstreamnt  +downstreamnt
atgctggacagggttgggccaggttttcaggacctgtgcaggcaagtgctgcccacactg
ccgacgctgagccaagaggaagtctctactatctgggcgaatgtttcagattttgtggaa
cgacagctaactatgcacaagggtgttcagatttcaggacttggaactttcactttctca
aggcagcagcttgaggtgggaaacaagaagtttgttctagtgcagaggccggtgtttatc
atggcagagaagttagtgcagacccacggactcaaacaaaacaaagtattttctcctggt
gatattccagttgttccacttaattttgtcatgatatccctggagggtccatttaacagg
gatacaatagaagggtgtgttaaggagacactactttttttatcgagatccatttccgtc
aaacaaaaagtggagttcacattcaaaggaattggggtcctttcgatcagagacagcaaa
gtgaagatgagattttataaggacttcctctgttcgatggatggaagtggcatcttgact
aaagcccttgcgaataggcctggcaccatggactcggtgctgtctagcagagagtcctac
agaaagcgtcccaacagtgcgatggcctttccaaggattgagcacaaagagacagagaac
aaaacacccgtggaggtcgttggagaggaaggcggagagaacagaccaaggaagatcaag
ttgaaagaccagtcagacaaagaaggaggagccagggagatatcatcacccaagaaacac
cgtgagaggcaatctatctctcctgctaaagtgacaagcgtcagcttgctggacaagttt
gagcgaagtgggaacggtgggaagatcacggcctgtgaaaacttgtcatctccaggttgt
cagagaaacgacaatgagaggcccagaacatctcctgccccagcttgccaggatcataat
aaggcaggacaggaaatgtgctatgtgtgtttgcaacgagcacaacggaatttcgcattg
cactatggagatgagaggaggaggagagagattgaagatgagcgacttatgcaacagtac
caaatcctgaaagatcaggaggctttcttcaaaaaccaggtgaagggcatggctgctagg
gagcagaaccagaagaacgctgcctataacctcggagttgctgaagctatcaggaatcac
aagaacgagaaacccgaattctataaatccttcctctttgataagcgacctcttagtcct
gagattaacgcttttaagcaggaggaatattcccaaagtctcctgaaacaaatggaaagc
aaacgggagaaggaaataaagcaaagacaaaacagagagttgatggaccgcttggagcaa
gtgcagctcacagaggaacttgctgcacaaagagctcaatatctaaaagagaagatggaa
gaaacacagcactacaagagagctttggatgcacaggtaaagaacaaacccccccagctg
cccatgtttgagccagactctgctgagcccatctttggtaagaatgacggagaaagggag
atggaaaagcgaaagcgagagcagagctgcatgaagcatcagatggaggcagccgccagc
cacaagaggaacaccatcctgaaccagctggtggaccagaggcgagatctgcagatgctt
cagaggacacagagagagcacatggcagacagagctgctgagatggatcgagtgaacaga
ctcaaccagtgcttgcaagaggactgggacaggagcctggccatgaagaagcagcgggac
gtggaggaaaaggcctttgagcgggcttcggacaagctgtttctcttggatcagtgtgag
aagtatcggcgctgcaggcagtgccagaggcgcacctgcaacacgggcgagagcaacttg
tggcccatgaataagttcctgcagggctcacgattgctcgtgtag

DBGET integrated database retrieval system