KEGG   Mus musculus (mouse): 70894
Entry
70894             CDS       T01002                                 

Gene name
Efcab3, 4921510J17Rik
Definition
(RefSeq) EF-hand calcium binding domain 3
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: EF-hand_8 EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5
Other DBs
NCBI-GeneID: 70894
NCBI-ProteinID: NP_001074515
MGI: 1918144
Ensembl: ENSMUSG00000020690
Vega: OTTMUSG00000002985
UniProt: Q80X60
Position
11; 11 E1
AA seq 432 aa
MAVSEIKATMKLKPLKAPVFHKRDKDLRGSFSDHLKHKESKLSPAQLEAFRNAYNFFTKD
RTGCIDSHGLISTIAKLGMNLNTYDIYNELKCADLDRDGKINFSDFINVLTDKKLFLKAV
VPEKKICLDLANNPGILLFEILSKFVETSSLHRKDIIELVSYFRKRFQESHSEIMWSSYG
RRGLKSEICSPPRSSTAAFANSARISIMKERDLYKFLEALKRCNLRTDSPYSKIPVFPLF
PDVDGTVMGKPFKDTQKIEMLRRKEPLTFFEDYFFNKRDWKTQAMNVKPLKSASGYSDDI
LAIDHLFKKKQHWTVTDAAAIKQHVKKATESYNLGIALDHRKEMLNLWKKIRGDLVGIES
NNESFYNTFSTYTWSWNVCQELLSAKDLRLHDASMNKSSPSNSGLSSPSDFSESDPETGR
KRKRKSSRGFRQ
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggcagtttcagaaattaaagccacgatgaagctaaagcccttaaaagcacctgtcttt
cacaagagagataaagatttgcgaggatctttctcagaccatttaaagcacaaagaatca
aagctgagtcctgcacaacttgaagccttccgtaatgcttacaacttcttcaccaaggat
agaactggctgtattgattcacacggattgataagcaccatagcaaaactgggaatgaat
ctaaacacgtacgatatctacaatgaattaaaatgtgctgatctcgacagggacggtaag
atcaacttctcagattttataaatgtgttgacagataagaaactcttcctcaaggctgtg
gttccagaaaagaaaatatgcttagatttagctaacaacccaggaatcttgttgtttgaa
atcctatcaaaatttgtagaaacctcgtccctgcacagaaaggatataatagagctagta
agctatttccgaaaaaggttccaggagagccactcagaaataatgtggagttcgtatggg
agaaggggcctaaagtcagagatctgctctccccctcgctcgagcactgctgcctttgcc
aactctgctaggatctccataatgaaagaaagggatttgtataagtttctcgaagccctc
aaacggtgtaatctccgtacagatagcccatactcaaaaatacctgtgtttccgttgttt
cctgatgtggatgggacggtgatgggaaaaccatttaaagacacacaaaaaatagagatg
ctaaggagaaaggagcctctgactttctttgaggactattttttcaataaaagagattgg
aaaacacaggccatgaatgtgaaacctctcaagtctgcctcaggctattcagatgacatc
ttagccattgaccacctgttcaagaaaaagcaacattggactgtgactgatgcggctgct
atcaaacagcatgtaaagaaagccacggagagttataacttaggaattgcccttgaccac
cggaaagaaatgctgaacctctggaagaagattcgaggggatttggttgggatcgaaagc
aacaatgagtccttttacaacaccttttcgacctacacctggtcctggaacgtctgccaa
gagctgctctccgctaaggacctccgcttgcacgacgccagcatgaacaagagttccccc
tccaactctgggttatcttccccatcggacttcagtgagtctgacccggagacggggagg
aagaggaaacggaaaagttccagagggtttcggcaatga

DBGET integrated database retrieval system