KEGG   Mus musculus (mouse): 70930Help
Entry
70930             CDS       T01002                                 

Gene name
Nol8, 4921532D18Rik, 5730412B09Rik
Definition
(RefSeq) nucleolar protein 8
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7
Motif
Other DBs
NCBI-GeneID: 70930
NCBI-ProteinID: NP_001258326
MGI: 1918180
Ensembl: ENSMUSG00000021392
UniProt: Q3UHX0 E9QKD1
Position
13 A5; 13 25.36 cM
AA seq 1165 aa AA seqDB search
MERPLENVSSNLDRCPTSMQGNREMKRLFVGGLGQGISETDLQNQFGRFGEVSDVEIITR
KDDQGNSQKVFAYVNIQITEADLKKCMSILNKTKWKGGTLQIQLAKESFLHRLAQEREDA
KAKKEKSTTGNPTLLEKMGAVDFHMKAVPGTEVPGHKNWVVSKFGRVLPVLHLKNQQKHK
IMKYDPSKYCHNIKKIPENLTETTPIAELTWELEGGNDPMSKKRRGEFSDFHIPPQKVKK
VQKSNDPMESKVSNIGLRTNQVMEKNKSTHPVTAHGTAPSTVNPSKQLLVSSSGTQKPKH
VVFHNSDFEIIWNKSSMSDDDVDSEDELKMMIAKEENREKPGHSSVNESEHDTFEVVRDD
FKSNIHKLSSSVSLGNNHEYDSSDTDEIIAMKTKNAKVKNSAESSQPERTVSKKSSFQKI
EPSNDCIKVQGINSNKESALCHGVKFVNPKFPPDSSGSDSEESEEDEEYKVLMENCPRVS
LTLADLEQLAGSHRKFPGKDSETNGPQNDSHCKFDTTSKNPKTSGDLYNGRQQCILPEEI
VASLLEDENTYSKQKSEEDILKPKFQAFKGIGCLYAKESVDKTLKENIAFNTGGGHHSSL
KHEDHNRSLMENGSKCVNGSSSKLTSCQPAKKVNDPNHIQPPKRQCTFENQNHKVMSSTS
CDKGSTNPLPGPLPLKAKTSLHLSANSHKVDSDGDACHWPESRKALEKERTNLSNLESLE
KSSKVSPREDPQKSPAGFSLSDSNASCINAKDKQAEDNQKRLAALAAWQKAREVQKKLVH
SALANLDGHPEDKKTHIVFASDNESETEETSTQEQSCPEKELMKESVSKSPGKLFDSSDD
EDSDSKEDSTRFSIKPQFEGRAGQKLMDLQSQFGSDERFRMDSRFLESDSEDEKKELNED
KVNEDELAAEKKKTLNVVQSVLNINVNNPTNKGSVAAKKFKDIVHYDPTKHDHAIYERKQ
EDKEKESKATRKKKKEEAEKLPEVSQDMYYNIAADLKEIFQSMSNTDEKEEDVPRTEAGA
REGTGKIRNAETLACEPEQTTGFTFSFFDSATKDEKDATYRIELVKHGKIVCPNDPRFQD
SSSEEEDIAEEADHSKPSPGEAVPENEAIRFFFFSENDDRLRGSNLFWSGMGGSISRNSW
EARTSSLLLECRKKHKEAKRKVKAN
NT seq 3498 nt NT seq  +upstreamnt  +downstreamnt
atggagcgacctctggaaaacgtttccagcaatcttgatagatgcccaacatccatgcaa
ggcaacagagaaatgaagcgcctctttgtgggtggacttggacagggcatttctgagaca
gacctacaaaatcagttcggcagatttggagaagtttctgacgtggagatcatcactcgg
aaagatgaccaaggaaattcacagaaagtctttgcgtatgttaacattcaaataacagaa
gcggacctgaagaaatgtatgtctattttaaacaaaacaaaatggaaaggtggaacacta
caaattcagctagcaaaagaaagctttttacacagattggcccaagaaagagaagacgca
aaagcaaagaaagaaaaatcaacaacaggcaaccccaccttattggaaaagatgggagca
gtggatttccatatgaaggctgtgcctggaacagaagtaccagggcataaaaattgggtt
gtgagtaagtttggaagagtcttacctgttcttcaccttaagaatcaacaaaaacataaa
attatgaaatatgatccatcaaaatactgccacaatataaaaaagattccagagaatttg
acagaaaccactcccatagctgaactcacttgggaattggaaggaggcaatgaccctatg
agtaagaaacgtcgaggagagttctctgactttcatatccctcctcaaaaggtcaagaaa
gtgcagaagagcaatgatcccatggagtccaaggtttctaatattggtctaaggactaat
caggtaatggagaagaacaaatcaacacatcctgtgactgcacacgggacagcccctagt
actgttaatccttctaaacaactccttgtgtccagttctggtactcagaaacctaaacat
gtggtttttcataattctgactttgaaattatctggaataaaagtagcatgtctgatgat
gatgttgactcggaagatgaattaaaaatgatgattgcaaaagaggaaaacagagagaaa
cctgggcattcctcagtcaatgagtctgaacatgatacttttgaagttgttagggatgat
ttcaaatcaaatattcacaagctttcttcttcagtaagcctaggaaataaccatgaatat
gattcaagtgatacagatgaaattattgcaatgaaaacaaaaaatgctaaggtcaaaaac
agtgcagaatcttcacaaccagaaaggactgtaagcaagaaaagttcttttcaaaagata
gaaccttctaatgactgtataaaagtacaaggaattaacagcaacaaagaatcagccctg
tgtcatggagtaaagtttgtaaatcccaaatttccacctgactccagtggcagtgacagt
gaagagtccgaagaagatgaagaatataaagtcttgatggaaaactgtccccgtgtgagt
ctcactttggctgacttggagcagttggctggcagtcatcggaagtttccaggaaaagac
agtgagactaatggtccacaaaatgacagtcactgcaaatttgacacaacctccaagaat
cccaagacttctggtgacctgtacaatggcagacaacagtgcattcttcctgaggagatt
gtggcctcccttttagaggacgagaatacttacagcaaacaaaaatcggaagaagatatc
ttaaagccaaaattccaggccttcaagggaataggctgtctctatgcaaaggagtcagta
gacaaaactttgaaagagaatattgcctttaatactggcggtgggcatcacagttcctta
aaacatgaagatcacaatagaagtttgatggaaaatggatctaagtgtgttaatggctca
tcaagcaaactgacttcatgccaacctgcaaagaaggtgaatgacccgaaccacattcag
cctccaaaaagacagtgtacttttgagaaccagaaccataaagtaatgtcctctactagt
tgtgacaagggaagtacaaatcctctcccaggtccgttgccattgaaagctaaaacatcc
ctgcatcttagtgccaacagtcacaaggtagactctgatggagacgcttgccattggcct
gaaagtagaaaagctttagagaaagagaggaccaatttaagcaacctcgaatctcttgag
aaatcatcaaaggtgtctcccagggaagaccctcagaaaagcccagctggtttctcactt
tctgatagtaatgcatcctgtataaatgctaaggataaacaagctgaagacaaccagaag
cgattggccgccttggcagcatggcagaaagccagggaagtacagaaaaaactggtgcat
agtgccctggcaaatttggatggtcatccagaggacaaaaaaacacacattgtctttgct
tctgataatgaaagtgaaacggaagagacatccactcaggagcaaagctgtccagaaaag
gagctgatgaaagaatctgtgagtaaatcgcctgggaagctgtttgacagcagtgatgat
gaagactcagattccaaggaggacagcaccaggttcagcattaaacctcagtttgagggc
agagctggccagaagcttatggatctgcagtctcagtttggaagtgatgagagattccgc
atggactctagatttttagagagtgacagtgaggacgaaaagaaagagctaaatgaagat
aaagtgaatgaagacgagcttgctgcagaaaaaaagaaaaccctgaatgttgtgcaaagt
gttttgaacatcaatgtgaacaacccgacgaacaaaggatcagtggctgctaagaaattt
aaggatatcgtacattatgacccaacaaagcatgaccatgccatttatgaaagaaaacaa
gaagataaagaaaaagaaagtaaggcaacacggaagaagaaaaaggaagaagcagagaag
ctgcctgaggtatcccaagacatgtattataacattgctgcagatttgaaagaaatattc
caaagtatgagcaacacagatgaaaaggaagaagatgtgcccaggactgaggctggtgct
agagaggggactggaaaaatcaggaacgccgagacactggcatgtgagcccgagcaaacc
actggctttacattctctttttttgattcagccactaaagatgaaaaggatgccacctat
agaatcgaactagtgaaacatgggaagatagtctgtccaaatgatccccgattccaagac
agtagttcagaagaagaagatattgctgaagaagcagatcatagcaagccaagccctgga
gaagcggttcctgagaatgaggccattagatttttctttttctctgagaatgacgacaga
cttcgtggttctaacttattctggagtggtatgggaggtagtattagcagaaattcttgg
gaagcccgaacaagtagtctccttttggaatgtcggaagaaacataaagaagccaaaagg
aaggtgaaagcaaattaa

DBGET integrated database retrieval system