KEGG   Mus musculus (mouse): 71020Help
Entry
71020             CDS       T01002                                 

Gene name
Spats1, 1700011H05Rik, 4933400B06Rik, Ddip, Srsp1
Definition
(RefSeq) spermatogenesis associated, serine-rich 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: SASRP1
Motif
Other DBs
NCBI-GeneID: 71020
NCBI-ProteinID: NP_081925
MGI: 1918270
Ensembl: ENSMUSG00000023935
UniProt: A2RRY8
Position
17; 17 B3
AA seq 269 aa AA seqDB search
MESSKDTQHGDALESKSCLANRTSSRQNKRTSLSSSDGTGPRVTESLGLPRVLTPSDTAA
ELGQKTSSSSSSSSSSAQSNRSSKVSLPEIPKEKYPEEFSLLNSQTEDGQRPEWTFYPRF
SSNIHTYHIGKQCFFNGVFRGNRRSVAERTVDNSLGKKKYDIDPRNGIPKLTPGDNPYMF
PEQSKEFFKAGATLPPVNFSLGPYEKKFDTFIPLEPLPKIPNLPFWEKEKANNLKNEIKE
VEELDNWQVPMPFLHGFFSTGASNFSRQQ
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggagtcttccaaggatacccagcacggtgatgctctagaatctaaaagttgcttggct
aacaggacgtcctctcgtcagaacaaaaggaccagcctctcgtcttctgacggaacaggt
ccgagagtcactgagtccctaggccttcccagggtgttgactccctctgacacggctgcg
gagctgggtcagaagacctcctcctcttcgtcttcctcctcttcctctgctcagtctaat
cgttcctcaaaagtttcgctgcctgaaatcccaaaggaaaaatatcccgaggaattcagc
ctgctcaattcacagacagaagatgggcagcgtcctgagtggacattttatccaaggttc
agcagcaacatccacacctaccacattggaaagcagtgcttcttcaatggggtcttccgg
ggcaacaggaggtctgtggcagagaggacagtggacaacagcctcgggaagaagaaatac
gatattgatcccagaaatggaatccccaaattgacaccaggggataatccgtacatgttc
ccagaacagagtaaagagttcttcaaagcgggagcaactttgcctccggtgaacttctca
ctgggaccttacgagaaaaaattcgacacatttatcccacttgagccacttccaaaaatt
cccaatctgcctttctgggagaaggaaaaagccaacaatttgaagaacgagataaaagaa
gtcgaggagcttgacaactggcaggtgccgatgcccttcctacatggtttcttctccact
ggtgcttccaacttttcaagacaacaatga

DBGET integrated database retrieval system