KEGG   Mus musculus (mouse): 71063
Entry
71063             CDS       T01002                                 

Gene name
Zfp597, 4933407K12Rik, AI462383, AI666357
Definition
(RefSeq) zinc finger protein 597
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    71063 (Zfp597)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    71063 (Zfp597)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    71063 (Zfp597)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_jaz zf-C2H2_8 zf-met zinc_ribbon_15 Zn-ribbon_8
Other DBs
NCBI-GeneID: 71063
NCBI-ProteinID: NP_001028331
MGI: 1918313
Ensembl: ENSMUSG00000039789
Vega: OTTMUSG00000026609
UniProt: E9Q6S0
Position
16; 16 A1
AA seq 419 aa
MASTLPTSDEQRPLLFEDLDVYFSQEECVSLHPAQKTLSREAPLKSFENLDSIGGEDQTE
SSQELSLEPVELEELSLEKDSIAAPVVHYSEQSEQDDEILEDKMSGGTLTCKTKLISLLV
TIDNQTPLVELSQCLGVKTLSDIIEVPWEEAKNVYKCPDCDQSFSDNTYLVLHQKIHLRE
KKYKCSTCEKTFSHRTNLRTHKRIHTGEKPYKCTECAASFRQQSHLSRHMNSHLKEKLYT
CSVCGRGFMWLPGLAEHQKSHTDKKSYECADHNREANLALPEERGSSDTLPQHTHCVKTL
EQPSDPTLPEKDHKEDSKNCSIDDEDFFSFSRFKPLQCLDCDMTFPCFSELVSHQTIHDL
EKPHKCKTCTKTFAFESELVSHEKSHRREEPFKCTVCGKSFSVSMQLVTHKRAHRRNSK
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggcgtccacgctccccacatcggatgagcagagaccactgctatttgaagatctggat
gtgtatttttctcaagaggaatgtgtgagtctgcaccctgctcagaagaccctcagcaga
gaagccccattgaagagttttgagaatttggactcgataggaggggaagaccagactgaa
agcagtcaggagttgagcctcgagcctgtggaacttgaagagctgtctctagaaaaggac
tccattgctgcacccgttgttcactactctgagcaatctgagcaggatgatgaaatactt
gaagacaaaatgtcaggtggaacgttgacttgcaagaccaaacttataagcctcttggtt
accattgacaaccaaaccccattagtagaattatctcaatgtttaggagttaaaacactt
tcagatattattgaagttccttgggaagaagccaaaaatgtgtacaagtgtcctgactgt
gaccaaagcttcagtgataatacataccttgttttgcatcagaaaattcatttaagagag
aaaaagtataaatgtagtacctgtgagaagaccttcagtcaccgaaccaacctgaggaca
cataagcgaatccacactggtgagaagccttacaagtgtaccgagtgtgctgccagcttc
cgacagcagtcacacctgtctaggcacatgaatagccatttaaaggagaaactatataca
tgtagtgtatgtgggagaggttttatgtggctcccaggattggcagaacatcagaagagt
catactgataagaaatcttatgaatgtgctgaccacaatcgggaagcaaatctggctttg
cctgaagagagaggttcatcagacacactgccccagcacacacactgtgtgaagaccttg
gagcagccctcagaccctactctccctgagaaagaccataaggaggactcgaaaaactgc
agtattgatgatgaggactttttttcattctccagattcaaacccttacagtgtcttgat
tgtgacatgacttttccttgtttctcggagcttgtctctcaccaaaccattcatgacctg
gaaaaacctcataagtgcaaaacatgtacaaaaacttttgctttcgagtcagagcttgta
tcccatgagaagagccacagaagagaagagccttttaaatgcacagtgtgtgggaagagt
ttcagtgtgagtatgcagctcgtcactcataaacgagcccataggagaaacagcaagtaa

DBGET integrated database retrieval system