KEGG   Mus musculus (mouse): 71085Help
Entry
71085             CDS       T01002                                 

Gene name
Arhgap19, 4933411B03Rik, AI120128, AW546831, mFLJ00368
Definition
(RefSeq) Rho GTPase activating protein 19
  KO
K20640  Rho GTPase-activating protein 19
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    71085 (Arhgap19)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    71085 (Arhgap19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP Endonuc-dimeris KAsynt_C_assoc PMI_typeI
Motif
Other DBs
NCBI-GeneID: 71085
NCBI-ProteinID: NP_081943
MGI: 1918335
Ensembl: ENSMUSG00000025154
Vega: OTTMUSG00000042088
UniProt: Q8BRH3
Position
19; 19 C3
AA seq 494 aa AA seqDB search
MAAEAPSGGEAPVCDSGRSDAICNFVICNDSPLRGQPIIFNPDFFVEKLRHEKPEVFTEL
VVSNITRLIDLPGTELAQLMGEVDLKLPGGAGPAAGFFRSLMSLKRKEKGVVFGSPLTEE
GIAQIYQLIEYLHKNLRVEGLFRVPGNSVRQQLLRDALNNGTDIDLDSGEFHSNDVATLL
KMFLGELPEPLLTHKHFHVHLKIADLMQFDDKGNKTNIPDKERQIEALQLLFLILPPANR
NLLKLLLDLLYQTAKKQDKNKMSAHNLALMFAPHVLWPKNVTANDLQENIIKLNTGMAFM
IKHSQKLFKAPAYIRECARLYYLGSRTQMSKDDLDLTTSCHNMSFQLARCQRQNRVDPSS
QQEETQQHTEEALRELFQHVHNWPDSAKKKQLLRQFHKQSLTQTPGREPSTPRVQKRARS
RSFSGLIKRKVLGSQMTSEKKNSSPAPESVAMGELKKASKENMNLFFSGSPAGTVTPTRL
KWSEAKREGRKGFF
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgaggcgccgagtggaggggaggcgccggtctgcgactctggccggagtgat
gccatctgcaattttgtcatttgcaatgactctccccttcgaggtcagcctattatcttc
aatcctgacttttttgtggagaaactccgacatgagaaaccagaggtgttcaccgaattg
gtggtcagcaacatcacaaggcttattgatttgccgggaactgagttggctcagctgatg
ggtgaagtggaccttaagctgcctggaggggctggcccagcagcaggattcttcaggtct
ctaatgtctctcaagcggaaagaaaaaggagtggtatttggatctccgttgacggaggaa
ggcattgcccagatttatcagctgattgaatatctgcacaaaaacttgcgagtggagggc
ttgtttagagtaccaggcaacagtgttcgacagcagcttttgagggatgctctcaataac
gggactgatattgacttggattcaggagagtttcactcaaatgatgtggccacgctgctg
aagatgtttctaggagagttacccgagcccctgctgacccataaacattttcatgtacac
ctcaaaattgctgatctgatgcagtttgatgataaaggaaataagaccaacataccagac
aaggagcggcagattgaggccctgcagctgctcttcctcatcctccctccagccaatcgt
aacttgctaaagttactgcttgatctcctgtatcagacagcgaagaagcaagacaagaat
aagatgtctgcccataaccttgctcttatgtttgcaccccatgtcctgtggcccaaaaat
gtcactgcaaatgatcttcaggagaatatcataaagttaaacacaggaatggcttttatg
atcaaacactctcagaaactttttaaggctcctgcttatattcgcgaatgtgccagatta
tactatttgggctccagaactcaaatgtcaaaggatgaccttgatctgacaacctcatgt
cataacatgtccttccagctggcaagatgtcagagacagaacagggtagatccttcctct
cagcaggaggagacccagcagcacacagaagaggcgctgagagaactcttccagcatgtt
cataactggccagactccgcgaagaagaaacaacttctcagacagttccataagcagtct
ctgactcaaacaccagggagagaaccttctactcccagggtccagaagagagcccgctca
cgctccttcagtgggcttatcaagcgcaaagtcctgggcagtcagatgacttcagaaaag
aaaaacagttctcctgctccagagtctgtggccatgggggaactgaagaaagccagcaaa
gaaaatatgaacctgttcttctctggctctccagctgggacagtgacaccaacaagattg
aaatggtctgaggcgaagagagaggggagaaaaggattcttttga

DBGET integrated database retrieval system