KEGG   Mus musculus (mouse): 71091Help
Entry
71091             CDS       T01002                                 

Gene name
Cdkl1, 4933411O17Rik
Definition
(RefSeq) cyclin-dependent kinase-like 1 (CDC2-related kinase)
  KO
K08824  cyclin-dependent kinase-like [EC:2.7.11.22]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    71091 (Cdkl1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     71091 (Cdkl1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  CDKL family
   71091 (Cdkl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 71091
NCBI-ProteinID: NP_899117
MGI: 1918341
Ensembl: ENSMUSG00000020990
UniProt: Q8CEQ0 Q14BG3
Position
12; 12 C2
AA seq 352 aa AA seqDB search
MEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKRFLETEDDPVIKKIALREIRMLKQLKH
PNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEPLVKNITWQTLQAVNFCHKH
NCIHRDVKPENILITKQSAIKLCDFGFARLLTGPGDYYTDYVATRWYRSPELLVGDTQYG
PPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSMNQYFSGVKI
PDPEDMETLELKFPNISYSALGFLKGCLHMDPAERLTCEQLLQHPYFDSIREVGELTRQH
DKPARKTLRQSRKHLTGLQYLPQLTSSRILPALDNKKYHCSTKRFNYHFPNI
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatgaaaaaattggaaagattggagaaggctcctatggggtagtgttcaag
tgcagaaacagggacacgggtcagatcgtggccatcaagaggtttctggaaaccgaagat
gaccctgtcataaagaaaatcgcccttcgagaaatccgcatgctcaagcaactcaagcac
cccaacctggtcaacctcctggaagtcttccggaggaagcggaggcttcacctggtgttc
gagtactgcgaccacacggtgcttcacgagctggatcggtatcagaggggggtaccagag
cctctcgtgaagaacataacttggcagacactgcaggctgtaaatttctgccataaacat
aactgcatacacagagacgtgaagccggaaaatattctcatcaccaaacagtcagccatt
aagctctgtgactttgggttcgcacggcttctcactggaccaggtgactactacacggac
tacgtggccacccggtggtaccgctcacccgagctgctagtgggagacacgcagtatggt
ccccctgtagatgtctgggcaattggctgtgtgtttgctgagttactgtccggagtgcct
ctatggccaggaaaatctgacgtggatcagctctacctgataaggaaaaccctgggggac
ctcattcccaggcaccagcaagtatttagcatgaatcaatacttcagtggggtgaaaatt
ccagaccctgaagacatggaaacacttgagttgaaatttccaaacatctcctactctgca
ctgggcttcttaaagggctgcctccacatggatcctgctgagaggctgacatgcgaacag
ctgttgcagcatccatattttgacagcattcgagaagttggggagttgacgagacaacat
gacaaaccagcgaggaagactctgaggcagagtagaaagcacttgactgggctgcagtac
ctacctcagctaaccagcagccgcatccttccagctttggacaataagaagtaccactgt
agtaccaagagatttaactaccattttccaaatatttaa

DBGET integrated database retrieval system